SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014913 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014913
Domain Number 1 Region: 200-309
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.29e-26
Family Canonical RBD 0.0000629
Further Details:      
 
Domain Number 2 Region: 117-200
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.75e-25
Family Canonical RBD 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014913   Gene: ENSMODG00000011898   Transcript: ENSMODT00000015186
Sequence length 377
Comment pep:known_by_projection chromosome:BROADO5:5:34846674:34864139:-1 gene:ENSMODG00000011898 transcript:ENSMODT00000015186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEHFGGDGAAAAAAPEAGGGAAAAAATEQEGTMAATAAAVATAAPAAPAAAPVAGAGA
GAGAGAGAGAGSGAGGTEGPGAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKM
FIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVVMDQK
EHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNK
TNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGR
ARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSG
YGKVSRRGGHQNSYKPY
Download sequence
Identical sequences F7EH18
ENSMODP00000014913 ENSMODP00000014913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]