SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014920 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014920
Domain Number 1 Region: 372-550
Classification Level Classification E-value
Superfamily SPOC domain-like 2.47e-48
Family SPOC domain 0.00037
Further Details:      
 
Domain Number 2 Region: 9-164
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.64e-30
Family Canonical RBD 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014920   Gene: ENSMODG00000011903   Transcript: ENSMODT00000015193
Sequence length 552
Comment pep:known_by_projection chromosome:BROADO5:6:278298779:278300437:-1 gene:ENSMODG00000011903 transcript:ENSMODT00000015193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNL
DMAHRAKVAMSGRVVGRNPIKIGYGKANPTTRLWVGGLGPNTSLAALAREFDRFGSIRTI
DHVKGDSFAYIQYESLDAAQAACVQMRGFPLGGPERRLRVDFAKAEETRYPQQCQATPLP
VHYELLPEGYTRHRNLEADLRVRDRTPPHLLYSDRDRSFVEGDWASPSKSTDRRNSLDSY
SRSVRSRSGERWGSEGDRGPSKPWEERRKRRSLSSDHGRTTHSPYEERGRTKASGLPSDR
SPERPRRENHTSESGAEKESSNSLPNNRHGTEERGPDSHQVKKRDSERNHRTSEVESKPL
EEPKPETKKLKSLSEYAQTLQLGWNGLLVLKNSCFPTCMHILEGDLGVISGLLKDHASGS
KLTQLKIAQRLRLDQPKLDEVTRRIKQGSPNGYVVLLATQASPGGPGTEGTHTVEPGLQR
RLLRNLVSYLKQKQAAGVISLPVGGTKGRDNTGMLYAFPPCEFSQQYLQSALRTLGKLEE
EHMVIVIVRDTA
Download sequence
Identical sequences F7EGS0
ENSMODP00000014920 ENSMODP00000014920 13616.ENSMODP00000014920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]