SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014933 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014933
Domain Number 1 Region: 227-337
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.36e-28
Family Canonical RBD 0.00012
Further Details:      
 
Domain Number 2 Region: 136-221
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.75e-24
Family Canonical RBD 0.0000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014933   Gene: ENSMODG00000011916   Transcript: ENSMODT00000015207
Sequence length 417
Comment pep:known_by_projection chromosome:BROADO5:5:34901118:34905637:-1 gene:ENSMODG00000011916 transcript:ENSMODT00000015207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPPRLSQVPPPLFPSPPSALAPRNLSHWRPRAPRQLAPLLPSLSSGSARQGARRAPRH
VTAPQPSRLAGGASIKGGRRRRPDLFRRHFKSGSIHRAAAATPSPRHLPPADSPAAMEDV
NEYSNMEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDP
VTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPD
TSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLENRYHQIGSGKC
EIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNS
AYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY
Download sequence
Identical sequences F7E028
ENSMODP00000014933 XP_001362287.1.35504 13616.ENSMODP00000014933 ENSMODP00000014933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]