SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015013 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015013
Domain Number 1 Region: 30-114
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-23
Family Canonical RBD 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015013   Gene: ENSMODG00000011981   Transcript: ENSMODT00000015288
Sequence length 163
Comment pep:novel chromosome:BROADO5:3:495034161:495034649:-1 gene:ENSMODG00000011981 transcript:ENSMODT00000015288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNVLTKLEHIHELNEQDMEHGDAQKVTLHAEYKESPWIFVGEFPYELTEGDIICVFSQYG
EIVNINLVQDRETGKSKGFCFLCYRDQRSTILTFENFNGIKIRERTIRVDHVANYRTPKD
SKHLDDVTRTLQAKCDGVKTQFPGFPESSEDERLLRKHKKAKR
Download sequence
Identical sequences F7B9L2
ENSMODP00000015013 ENSMODP00000015013 13616.ENSMODP00000015013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]