SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015015 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015015
Domain Number 1 Region: 5-552
Classification Level Classification E-value
Superfamily SIS domain 1.45e-228
Family Phosphoglucose isomerase, PGI 0.0000000000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015015   Gene: ENSMODG00000011980   Transcript: ENSMODT00000015290
Sequence length 554
Comment pep:novel chromosome:BROADO5:1:425545034:425571337:-1 gene:ENSMODG00000011980 transcript:ENSMODT00000015290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFTQDPNFLKLIQWHQKHGSELNLRRLFETDQDRFSHFSLNLDTQNGHILVDYSKNLI
TGDVMKMLIELAKSRGVEKAREEMFKGKKINFTEDRSVLHVALRNRSNTPMLVDGKDVVP
EVNKVLEKMKTFCECVRGGEWKGYSGKTITDVINIGIGGSDLGPLMVTEALKPYSKDGPR
VWFVSNIDGTHIAKTLAELNPETSLFIIASKTFTTQETITNAETAKEWFLQEAKDPSAVA
KHFVALSTNAPKVKEFGIDTQNMFEFWDWVGGRYSLWSAIGLSIALHIGFDNFEQLLSGA
HWMDNHFLTTPLERNAPVVLAMLGIWYINCFGCETQALLPYDQYMHRFAAYFQQGDMESN
GKYITKSGARVNYNTGPIVWGEPGTNGQHAFYQLIHQGTRMIPCDFLIPVQTQNPIRNGL
HHKILLANFLAQTEALMKGKTEEEARKELEVAGKSGDALKKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIAMYEHKIFVQGVVWDVNSYDQWGVELGKQLAKKIEPELDSDKPVTSHDA
STNGLINFIKQHWA
Download sequence
Identical sequences F7B9J9
ENSMODP00000015015 ENSMODP00000015015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]