SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015019 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015019
Domain Number 1 Region: 227-493
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-80
Family Protein kinases, catalytic subunit 0.00000000295
Further Details:      
 
Domain Number 2 Region: 116-258
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-37
Family SH2 domain 0.00000389
Further Details:      
 
Domain Number 3 Region: 17-165
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-21
Family SH3-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015019   Gene: ENSMODG00000011985   Transcript: ENSMODT00000015294
Sequence length 501
Comment pep:known_by_projection chromosome:BROADO5:1:560170712:560207388:-1 gene:ENSMODG00000011985 transcript:ENSMODT00000015294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVVSSKKLAKEKGKNQWNFKEPHIVFPKTPPPPLPPLVVFNHLTTPTPVLKPDQEEHYA
VALWDYEATNDRDLKVVKGEKLQILMKTGDWWLARSLVTKREGYVPSNFVTQVETLEVEK
WFFKTISRREAERELLAPVNKTGAFLIRESETIKGAYSLTVKDTTSAGNVIKHYKIRALD
DGGYYISPRVTFPSLRELVQHYSKKGDGLCQKLTMPCMILAPQTQWAQDEWEVPRHSLKL
VRKLGAGQFGEVWMGYYKNNIKVAIKTLKEGSMSPEAFLAEANLMKTLQHDKLVRLYAVV
TQEPIYIVTEYMAKGSLLDFLKSEEGCKLPFSRLIDIMAQIAEGMAYIEQRNSIHRDLRA
ANVLVSESLGCKIADFGLARIVDSEYTAHEGAKFPIKWTAPEAINFGVFSIKSDVWSFGI
LLMEIVTYGRIPYPGMTNPEVIRNLERGYRMPCPEMCPAELYSIISKCWRNRPEERPTFE
YLQSVLEDFYIATEQQYELQP
Download sequence
Identical sequences F7B9H2
ENSMODP00000015019 13616.ENSMODP00000015019 XP_001381646.1.35504 XP_007476307.1.35504 ENSMODP00000015019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]