SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015039 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015039
Domain Number 1 Region: 26-120
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.22e-29
Family Canonical RBD 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015039   Gene: ENSMODG00000012002   Transcript: ENSMODT00000015315
Sequence length 265
Comment pep:novel chromosome:BROADO5:3:493297801:493550338:1 gene:ENSMODG00000012002 transcript:ENSMODT00000015315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSLTKVKLINELNEREVELGVAEKVSWHAEYKDSAWVFVGGLPYELTEGDIICVFSQYGE
IVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGIKIRGRTIRVDHVANYRPPQDS
RHVGDVVRSIQEKGCGVKTPSPAFPESSEDERPLRKHKKAKKKRRKKERKKERKKERKKE
RRNPKKERKKERKKERKKERKKERKKERKKERKKERKKERKKERKKERKKERKKERKKEI
KKERKKERRKERKKERKKERKKERR
Download sequence
Identical sequences F7B8Y1
ENSMODP00000015039 ENSMODP00000015039 13616.ENSMODP00000015039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]