SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015118 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015118
Domain Number 1 Region: 1234-1508
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-57
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 249-498,527-601
Classification Level Classification E-value
Superfamily L domain-like 6.8e-40
Family Leucine rich effector protein YopM 0.053
Further Details:      
 
Domain Number 3 Region: 54-208
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000133
Family Ankyrin repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 625-814
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000502
Family G proteins 0.01
Further Details:      
 
Domain Number 5 Region: 1580-1650,1678-1772
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000183
Family WD40-repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015118   Gene: ENSMODG00000012068   Transcript: ENSMODT00000015399
Sequence length 2009
Comment pep:known_by_projection chromosome:BROADO5:1:139483507:139654207:1 gene:ENSMODG00000012068 transcript:ENSMODT00000015399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYWCVGTEASAVGQDHIMDHGQDGSVDMGSKQSTLGNVSIDQSPMIESIQAAYKKGKASK
VQELVKVFEESVSHLEKCQLLSITAAYGDLEAVRYLLKEKFVELPTEPNDDNPAVVAAYF
GHMDVVKELLDSLLGPCSYQRLLNWMLAIACQQGHLDVVKLLVLTYSADPESYAVRKNEF
PVIIRLPLYAAIKSGNEDIAIFLIRHGAFFCSYILMDSPDLSKHLLRKYFIEASVSRTGS
PTKAALHVKWSHLKLPWVDLDWLIDISCQITELDLSANCLTSLPSVIPWGLINLRKLNLS
DNQLVELPSVQSSDEIICTRLLEIDISSNKLLHLPPGFLHLSKLQKLTATKNYLEKLFEE
ENATNWIGLRKLQELDLSDNKLTELPTVFLHSFKSLNCLNVSRNKLKIFPDPWACPLKCC
KAAKNLLEYLPDKIAVFWKNHLKELDFSENALKDVPLGLFQLDTLMSLKLLGNQLISLPS
QDKWTCKQLKYLDLSKNQLGKNEDGLKTRRISFFNTKNRQRSCTESSSGLEFPAFLSESL
EVLCLNDNQIDMIPQSVCLLKGLSELYLGNNPGLRELPPELGQLANLWQLDIEELNISNV
PAEIQKEGPKTILAYLRAQLRKAEKCKLMKMIIVGPPRQGKSTLLEILQTGRPPQMMHSD
ATIRTSKWELQKPPGSKAKVDSVEFNVWDIGGPASMSTVNQCFFTDKALYVVVWNLALGE
EAVANLQFWLLNIEAKAPNSVVLVVGTHLDLIETKFRVERIATLRAYVLALCRSPSGSRA
TGFPDITFKHLHELSCKSLEGQEGLRQLIFHVTCNMKDTGSTIGSQKLAGRLIPRSYLSL
QEAVIAEQQRRNQADDVQYLTDKQIEQIIEQTPGNDINDYEDLQSAISFLIETGTLLHFP
DTSHGLRNLYFLDPIWLSECLQRIFNIKSSKSVAKNGVIRAEDLRMLLVGTGFTEQTEEQ
YFQFLAKFEIALPVANDSYLLPHLLPAKPGLDTHGLRHQAANTIQRVFKMSFVPVGFWQR
FIARMLISLAEMDLQLFENKKNTKNRNRKVTIYSFMGSQRNRCSTFRVKRNQTIYWQEGL
LVTFDGGYLSVESSDVNWKKKKSGGIKIICQSEVRDFSAMAFITDHINSLIDQWFPALTA
TESDGTLLMEQYVPCPICESSRTLQNDLNEKIEDVQYFDMEDCVLTAIEQDFITCPSHSD
IPVPLQELVPELFMTDFPARLFLENSKLECSENENNVLGQGGSGTIIYQAQYHGKPVAVK
RFQLKKFKNFANATADTMLKHLRAMDAMKNFSEFRQEASMLHSLQHPCIVSLIGISIHPL
CFALELAPLGSLTTVLSEKSKGSSFMPLGHMLTQKIAYQIVSGLAYLHKKNIIFCDLKSD
NILVWSLDVKEHMNIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIVYDEKVDMFSY
GMVLYELLSGQRPVLGHHQLQIAKKLSKGIRPVLGQPEEVQFHRLQALMTECWDTKPEKR
PLAVSVVSQMKDPTFATFMYMLHCGKQTSFFSSPGQEYTVVFWDGKEESRNYTVVNTEKG
LIEVQRMSCLGMKLSCQLKIQSALWTATEDQKIYIYSLKGMCPLNAPQNALDTPAVVTCF
LAVPVMKKNSYLVLAGMSDGLVAVFPVIQGIPDKNCSYLCSHTANRSKFNITDDDPRQNP
YPVRTMEIANSGSEVWYSNGPGILIIDCATLEINRRLDPYSPPSMITSMVVNSECHGEEV
VWCLDDKDNSVVMFFSATYQLCARYFCGDCSPLRDTFPVEQPILGLSTADMASQKHPVGD
CIADVSIIFSEELGTQILNHQNSLTDYCSMSSYSSSPSNRINRSFSSLPNLPMSSSTVPF
PTDYEDSDKFHEPNFCSDGSEKDGPLLNSEASTHLQAVKILSVKDLIWIPRQGGDVIVIG
LEKESGTQRGRVIAVLKARELAPYGTLVEAAVVAKDTVVCCFEQENMEWCLAVWRGWGAR
EFDTFYQSYEELGRLEAGMRKRRTQELCL
Download sequence
Identical sequences F7G536
ENSMODP00000015118 ENSMODP00000015118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]