SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015145 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015145
Domain Number 1 Region: 14-54
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000465
Family BRCT domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015145   Gene: ENSMODG00000012092   Transcript: ENSMODT00000015427
Sequence length 54
Comment pep:novel chromosome:BROADO5:1:556856513:556856674:1 gene:ENSMODG00000012092 transcript:ENSMODT00000015427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQNIIMQVVDKLKDFSISCEVCESTTHVVAGEPRRTLNVLLGIARGCWIVSYEW
Download sequence
Identical sequences F7G4N9
ENSMODP00000015145 13616.ENSMODP00000015145 ENSMODP00000015145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]