SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015185 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015185
Domain Number 1 Region: 251-518
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-84
Family Protein kinases, catalytic subunit 0.000000000134
Further Details:      
 
Domain Number 2 Region: 142-282
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-38
Family SH2 domain 0.00000134
Further Details:      
 
Domain Number 3 Region: 82-167
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-20
Family SH3-domain 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015185   Gene: ENSMODG00000012126   Transcript: ENSMODT00000015468
Sequence length 749
Comment pep:known_by_projection chromosome:BROADO5:1:457231811:457458688:1 gene:ENSMODG00000012126 transcript:ENSMODT00000015468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQPGKVLGDQRRPSLPALHFIKGAGKKESSRHGGPHCNVFVEHEALQRPVTASDFEPQ
GLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWC
EAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQ
RSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKR
NKPTIYGVSPNYDKWEIERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEV
EEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVL
LYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAK
FPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKNYRMER
PEGCPEKVYELMRACWQWSPSDRPSFAEIHQAFETMFQESSISDEVEKELGKKGVRSVVG
TFLQAPELPTKTRTSRRAAENKDASDLLDTSHPRSQGEGDPLDHEPAISPLLPRKERTPQ
DGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGHSDRRGGGDEEILN
GTFITAPLDTAEPSKFPSPSNGVNVTNGAVSGSSGFRSPHLWKKSITSTSSRLAANEEES
NTNPSKRFLRSCSASCVPHGAKDTEWRLL
Download sequence
Identical sequences F7FU48
ENSMODP00000015185 ENSMODP00000015185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]