SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015282 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015282
Domain Number 1 Region: 312-413
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-26
Family Zf-UBP 0.0044
Further Details:      
 
Domain Number 2 Region: 295-340
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000757
Family RING finger domain, C3HC4 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015282
Domain Number - Region: 205-260
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.015
Family Canonical RBD 0.061
Further Details:      
 
Domain Number - Region: 468-578
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0732
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015282   Gene: ENSMODG00000012206   Transcript: ENSMODT00000015567
Sequence length 608
Comment pep:known_by_projection chromosome:BROADO5:3:482668443:482702981:1 gene:ENSMODG00000012206 transcript:ENSMODT00000015567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPGKGPPRRPRPSRVLSPPEPVGARARAAPARPMSVSLVVIRLELADHSPLPAGFGFSAA
AGEEMSDEEIKEKTLASAKAHLEGKAPVEKAAIIHQHLGRREMTDMIIETIKSNPDEMKA
TMEERKSSEASSSPEKSRNADHSKEIAPDSPSKQLPDQISFFSGNPSVEIVHGIMHLYKT
NKMTSLKEDVRRSAMLCVLTVPASTGYDLMKFVAPFKEVIEHMKIIRDSTPNQYMVLIKF
SAQADADSFYMACNGRQFNSIEEDVCQLVYVERAEVVKSEDGASLPVMDLTELPKCTVCL
ERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEENKCFECGVQENLWI
CLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQ
YECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKET
IEKCDTLEHRLNDLLKEKQSVERKCTQLNVKLAKLSTELKEEQEMNKCLRANQVLLQNKL
KEEEKVLKETCDQKDMQITEIQEQLRDVMFYLEAQQKINHLPAETRQEIQEGQINIAMAS
AASSPSVG
Download sequence
Identical sequences F7CE61
ENSMODP00000015282 ENSMODP00000015282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]