SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015362 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015362
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.47e-25
Family Canonical RBD 0.00024
Further Details:      
 
Domain Number 2 Region: 396-479
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.27e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 3 Region: 276-355
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.35e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 4 Region: 192-267
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000126
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 5 Region: 484-562
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000137
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015362   Gene: ENSMODG00000012268   Transcript: ENSMODT00000015648
Sequence length 577
Comment pep:known_by_projection chromosome:BROADO5:2:201654721:201716921:1 gene:ENSMODG00000012268 transcript:ENSMODT00000015648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGK
VELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVESCEQVNTESETA
VVNVTYSNREQTRQAIMKLNGHQLENHSLKVSYIPDEQMAQGPENGRRGGFNSRGQPRQG
SPVVAGAPSKQQPVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA
EKAISVHSTPEGCSSACKMILEIMQKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK
KVEQDTETKITISSLQDLTLYNPERTITVKGSIENCCKAEQEIMKKVREAYENDVAAMSL
QSHLIPGLNLAAVGLFPASSSAVPPPPSSVSGAAPYSSFMQAPEQEMVQVFIPAQAVGAI
IGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFF
GPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENEQVIVKII
GHFYASQMAQRKIRDILAQVKQQHQKGQNNQTQARRK
Download sequence
Identical sequences F6YGA2
XP_001367379.1.35504 ENSMODP00000015362 ENSMODP00000015362 13616.ENSMODP00000015362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]