SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015438 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015438
Domain Number 1 Region: 19-128
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-26
Family Canonical RBD 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015438   Gene: ENSMODG00000012323   Transcript: ENSMODT00000015724
Sequence length 295
Comment pep:known_by_projection chromosome:BROADO5:4:218848320:218910789:-1 gene:ENSMODG00000012323 transcript:ENSMODT00000015724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METDSGAQTTNQTQTDSLSPSPNPVSPVPLNNPTSAPRFGTVIPNRIFVGGIDFKTNEND
LRKFFAQYGSVKEVKIVNDRAGVSKGYGFITFETQEDAQKILQEAEKLNYKDKKLNIGPA
IRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVASVPPPWPSRSISSSP
VMVAQPVYQQPAYHYQAPAQCLPGQWQWGVPQSPASSAPFLYLQPSEVIYQPVEIAQDGG
CVPPPLSLMEASVPEPYSDHGVQATYHQVYAQSAIAMPAPVMQPEPIKTVWSIHY
Download sequence
Identical sequences F7E2Z2
ENSMODP00000015438 ENSMODP00000015438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]