SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015543 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015543
Domain Number 1 Region: 8-71
Classification Level Classification E-value
Superfamily UBA-like 0.00000000969
Family UBA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015543   Gene: ENSMODG00000012413   Transcript: ENSMODT00000015830
Sequence length 555
Comment pep:known_by_projection chromosome:BROADO5:4:222021920:222266001:1 gene:ENSMODG00000012413 transcript:ENSMODT00000015830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELNTQVNIKEKIYAVRSVVPNKSNNEIVLVLQQFDNNVDRAVQAFMDGSAIQVLKEWN
MTGKKKNNKRKRSKSKQHQGNKDAKDKVDKAEAASLVPPGMYNCHVNGCDKDNSSTESTH
DKTERLPREKKPLALEEPLQAQPEVTEGSRLPRQRLSLDANPKPVPGIERSDGLQASAQP
QYCNTSRPKSKPSVVKSCTPATHPEVAADEVLKKRGPNIEKSVKDLQRCTVSLTRYRVMI
KEEVDNSVKKIKAAFAELHSCIIDKEVSLMAEMDKVKEEAMEILTARQKKAEELKRLTDL
SSQMAEAQLAELRAEIKHFVSERKYDEELGRSAKFSCDIEQLKTQIMLCGEISHPKNNYS
SRTPCSSLLPVLNAHTATSGKQNNYNRKPPSHKTSDNKAAVTKMPSNPPNANETSPQVIP
ATKQNGPSSQRRRFNPQYHNNRLNGPAKSQGNLSEADYPIKGNPRHDHRRQQHNSFRPKN
KGITKNQEPPLATKASENPAHSEKPRRKQHAVDAPDARPFRGSVARVTQCNLCPTRIEVS
ADAAVLSVPAVTLVA
Download sequence
Identical sequences F6PMD7
ENSMODP00000015543 13616.ENSMODP00000015543 ENSMODP00000015543 XP_007494645.1.35504 XP_007494646.1.35504 XP_007494647.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]