SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015585 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015585
Domain Number 1 Region: 2630-2678
Classification Level Classification E-value
Superfamily UBA-like 0.0000000176
Family TS-N domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015585   Gene: ENSMODG00000012443   Transcript: ENSMODT00000015874
Sequence length 4387
Comment pep:known_by_projection chromosome:BROADO5:4:381435415:381847008:-1 gene:ENSMODG00000012443 transcript:ENSMODT00000015874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEGLVAWVLNTYLGKYVSNLNTDQLSVALLKGAVELENLPLKKDALKELELPFEVKAGV
IGKITLQIPFYRPHVDPWVISISKLHLIGSPEKLQDFNDEKEKLLERERKKALLQALEEK
WKNECQQKGESYWYSVTASVVTRIVENIELKIQDVHLRFEDDMTNPSHPFAFGICIKNVS
MQNAVNEPVQKLMRKKELDVAEFSIYWDVDCTLLGDLPQVELQEAMDKSMESRNHHYILE
PVCASALLKRNCSKEPLRSRHTPRIECDIHLETIPLKLSQLQYRQIMEFLKELERKERQL
KFRKWKPKVAISKNCQEWWYFALNANLFEIREQRKRSTWDFALHRARDAVSYTDKYFNKL
KGALLSADEEEEMCRIEEEQSFEELKILHELVHDRFHKQEELAESLREPLSNSPGESPVD
PEAGGGSGMLQYLQSWFPGWGGWYGQQTPEGRPIEGLVTEKQEQWNPEEILGTEEFFDPT
ADASCMNTFTKRDHVFAKLNLQLQRGMVTLLHQEKGSPPENESAFMQLEFSDVKLLAESL
PRRNSSLLLVRLGGLFLQDLVTEGTMFPLLVFPNPQKEVGSVSQSLGLQTSSDKSDQCPA
TDPDSPVFEMLYEKNPVHSHFERRLNVSTRPLNIVYNPQAIKKVADFFYKGKVHTSGFGY
QSELELRVAEAARRQYNKLKMQTKAEIRQTIDRLLVGDFIEESKRWTVRLDISAPQVIFP
DDFKLKNPVLVVVDLGRILLTNTQDDYKKKSTEGSSSDMNELSDDEYKTPLATPPNTPPL
QTSSRNGVKTPPFPTVEFSEEQLQAHLMSTKMYERYSLSFMDLQIMVGRVKDNWKHVQDI
DVGPTHVVEKFNVHLQLERRLIYTSDPRYPGAVLSGNLPDLKIHINEDKISALKNCFALL
TTSETKSSDVLIKEKIFPEEAHRGSLQDSVMNLTQSIVVLEQHTREVLVESQLLLAEFKV
NCMQLGVESNGHYISVLKVFGTNAHFVKRPYDAEVSLTVHGLLLVDTMQTYGADFDLLMA
SHKNLSFDIPTGSLRDSRAQSPVSGPDVTTLSDRCIAATNVALDNIITKDQESLIKLEYQ
FVSSECPSMNLDSTLQVISLQVNNLDIILNPETIVELIGFLQKSFPKEKDDSSPQPLMTD
FERSFKEQETYQSTYEQNTEVAVDIHRLNLLLLRTVGMTNGEKYGRKIATASIGGTKVNV
SMGNTVDVNGSLGCLQLMDLTQDNVKNQYVVSIGNSIGYENIVSDIGYFESVFVKMEDAA
LTEALSFTFVEKTKQECSLNLKMASLHYNHSAKFLKELTLSMDELEENFRSMLKSAASKV
TTVLATKTAEYSEMVSLFETPRKPRDPFAFEENEVYGFDPCTTVSDTVKLILNVNIESPV
VSIPRKPGSPELLVGHLGRIFIQNFVAGEDESRSDRLQVEIKDIKLYSLNCTQLAGRKGS
GSEVSQSLHPPSGPASVTSQEETHFTRHDFFESLHRGQAFHILNNTTIQFKLEKIPLERE
CELTFTHCPDDVGISSIMKIEGKFVNPVQVVLAKHVYEQVLQTLDNLVYSEDLNKFTSNS
TSLPSPNSPLPSLSACGEPCVERKENGLFSHSSFSSTSQKSLSVREVKSFTQIQANFCIS
ELQVQLSGDLTLGAQGLVSLKFQDFDVEFSKDHPQTLSIQIALRSLLMEDLLEKNPDSKY
KNLMVSRGAPKPSSLVHKEYLSQSCPLVSNVEYPDMPRSLPSHMEEAPNVFQLYQRPTCV
SRKKQKEDKGKDYPLTPPPSPTVDEPKVFCGKSKFDDSLVHINIFLVDKKHPEFSSCYNR
INRSVDVDFNCLDVLITLQTWVVILDFFGIGSTADNHAMKAEPADIQHAVKSESSTVIEA
DVQDPVNTKLDLKVHSLSLVLNKTTSELAKANVSKLVAHLEMIEGDLALQGSIGSLSLSD
LTSHGEFYRERFTTSGEEALIFQIYKYGRPDPLLQRQHDIRVNLQMASVQYVHTQRFQAE
VVAFIQHFTQLQDVLGRQRAAIEGQTVRDQAQRCSRVLLDIEAGAPVLLIPESSRSNNLI
VANLGKLKIKNKFLFAGSPGTFSLQGKESAPLSSPLGTPKHSMKKTASIEDSKGTQSEGL
FMISPGGTSMTRLKNEPMPNTLTNLPGQQAHSPVSRAPSSPEDYICLLDCIVVDLQDMDI
FAAERRPREYSKASENISGDLTFPSYSVRQTGGSLLTEPCRLKLKVERNLDKEISHTVPD
ITIHGNLSSVHCSLDLYKYKLIRGLLENNLGEPIEEFMRPYDLQDPRIHTVLSGEVYTCM
CFLIDMVNVSLELKDKNGKEGSGSLARFDFKKCKLLFESFSNQTKSINLVSHSMMAFDTR
YSGQKTSPGMPNVFNCIFQPSKNSTTQGSIQIELHFRSTKDSSCFTVVLNNLRVFLIFDW
LLLVHDFLHTPSDVKKPDSVTPSRQRNYNSETTVFPKTVKSGVVTKRSSLPVSTERHLEV
KVNVTGTEFVVVEDMSCFDTNAIILKGTTVLTYKPRFVDRPFSGSLFGIEVFSCRLGNEQ
DTALSIIDPVQIQVELVGNSSYQNSSGLMDAFNSEDFPPILEIHLQNLDIRLSYNDVQLF
LAIAKSIPEQASVAVPDSAVLEAASASSHLPGSSWSCETPTISETRDSPRHTLDPLLELQ
LARLQELGFSMEDCRRALLVCQGQLKKAASWLFKNAEPLKSVSLVSNSKDNQGTLPTQLI
SGVEIKAESVCICFIDDCMDCDVPLAELTFSRLNFLQHVRTSPEGNAHFMLSGDYYNRAL
SGWEPFIEPWPCSVSWEQQAASRLHPPRLKLEARAKPRLDINITSVLIDQYVSTKESWMA
DYCKQDKEMDIVKSEGWMGSSVDPPCFGQSLPLVYLRTRSTASLTNLEHQIYAREMKTPK
RRQPFVPFALRNHTGCTLWFATLTTTPTRAALSHSGSPGLVPEGNRTFLDDAHNVSEWRE
VLTGEEIPFEFEARGKLRHRHTHDLRIHQLQVRVNGWEQVSPVSVDKVGTFFRYAAPDKN
SSSSTIGSPSSKTNIIHPQVYFSSLPPVRVVFAVTMEGSARKVITVRSALIVKNRLETPM
ELRLDSPSAPDKPVVLPAIMPGDSFAVPLHLTSWRLQARPKGMGVFFCKTPIHWTSVVKT
SEVSSSKRECHSMDTEKSRFFRFCVAIKKENYPDYIPSKILSDSAKQIFRQPGHTIYLLP
TVVICNLLPCELDFYVKGMPINGTLKPSKEAALHTADTSQNIELGLSLENFPLCKELLIP
PGTQNYMVRMRLYDINRRQLNLTIRIVCRAEGSLKIFISAPYWLINKTGLPLIFRQDNAK
TDAAGQFEEHELARSLSPLLFCYADKEQPNLCTMRIGRGIHPEGVPGWCQGFSLDGGSGV
RALKVIQPGNRPGLIYNIGIDVKKGRGRYIDTCMVNFAPRYLLDNKSSHKLAFAQREFAK
GQGTSNPEGYISTLPGSSVVFHWPRNDYDQLLCVRLMDVPNCIWSGGFEVNKNNSFHINM
RDTLGKSFFLRVEITLRGATYRISFSDTDQLPPPFRIDNFSKVPVVFTQHGVTEPRLRTE
VKPMTSLDYAWDEPILPPFITLTVKGAGSSEISCNMNDFQDNWQLYYENFIYIAATYTFS
GLQEGTVRPVTSNKDVTCGELVLDVSPKTQRVILKKKEPGKRSQLWRMTGTGVLVHEGSS
VPHNPNKPAASRTIEGSAILDIAGLAAVTDNRYEPLMLRKPDRRRSTTQTWSFREGKLTC
GLHGLVVQAKGGLSGLYDGAEVVLGPDTSLELLGPVPPEQQFIDHKMRPGSGILAIKVIP
DGPTRVLQITDFSQRKSDRSSYEVDDLPVTEQELRKFKSPDTKQELEVLVKLEGGIGLSL
INKTPEELVFASLTGINVHYTQLATSHMLELSIQDVQVDNQLIGTTQPFMLFVTPLSNEN
EVIETGPAVQVNAVKFPSKSSLTNIYKHLMITAQRFTVQIEEKLLLKLLSFFGYDQAESE
VEKYDENLHEKSNEQDGTPTRYYFENLKISVPQIKLSVFTSSKLPLDLKALKSTLGFPLI
RFEDAVINLDPFTRVHPYETKEFIINDVLKHFQEELLSQAARILGSVDFLGNPMGLLNDV
SEGVTGLIKYGNVGGLIRNVTHGVSNSAAKFAGTLSDGLGKTMDNRHQTEREYIRYHAAT
SGEHLVAGIHGLAHGIIGGLTSVITSTVEGVKTEGGVSGFISGLGKGLVGTVTKPVAGAL
DFASETAQAVRDTATLSGPRTQAQRVRKPRCCTGPQGLLPRYSESQADGQEQLFRLTDNI
QDEFFIAVENIDSYCVLISSRAVYFLKSGDYVDREAIVLEVRYDDLYHCLVSKDHGKVYV
QLTKKAVNTSSGVVIPGPSHQKPMVHVKSELLAVKLSQEINYAKSLYYEQQLMLRLSENQ
EQLELDS
Download sequence
Identical sequences F6PI25
XP_007491817.1.35504 XP_007491818.1.35504 XP_016277683.1.35504 XP_016277684.1.35504 ENSMODP00000015585 ENSMODP00000015585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]