SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015612 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015612
Domain Number 1 Region: 328-451
Classification Level Classification E-value
Superfamily SET domain 1.26e-33
Family Histone lysine methyltransferases 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015612   Gene: ENSMODG00000012475   Transcript: ENSMODT00000015901
Sequence length 458
Comment pep:known_by_projection chromosome:BROADO5:3:487142588:487160313:1 gene:ENSMODG00000012475 transcript:ENSMODT00000015901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELEGFFRDRLVRPPHFGDDETEARGVLTTYPGSRITGSRTPVSSAGQCSFQSPPPPHV
AFPHPLGWDGCGGGKRRGGMMGCRVSPRLPGVWPSLAGGGKKMSKTRAEEAAAAAAAAAA
AATPAGGAAAPAPGPETTDRRAPARPRTNGENVFMGQSKIYSYMSPHRASGTRPPLQEEN
SVAHHDVKCQGKALTELHKKGEEKRISGNAPASTMKSEEQKGKELRRDSLEPLPNHKTIA
AGNPKAMALPANAADAASAKHAPKKPPKTKQASRRKAQGKTQQNRKVTDYYPVRRSSRRS
KAELQSEEKRKLDELIESGKEEGMKIDIIDGKGRGVIATKQFTRGEFVVEYHGDLIEITD
AKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETDRLGRLINHSKCGNCQTKLHDIDG
VPHLILIASRDIKAGEELLYDYGDRSKASLEAHPWLKH
Download sequence
Identical sequences F6Q461
ENSMODP00000015612 ENSMODP00000015612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]