SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015619 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015619
Domain Number 1 Region: 22-116
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-30
Family V set domains (antibody variable domain-like) 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015619   Gene: ENSMODG00000023404   Transcript: ENSMODT00000015908
Sequence length 125
Comment pep:novel chromosome:BROADO5:3:524512502:524629859:1 gene:ENSMODG00000023404 transcript:ENSMODT00000015908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPLVCLSLLTFCSGSLSQDVVTQPPSASAALGSSARLSCTLSSELSGRTVVWHQQSPG
KAPRYLLYIYSSGGTGRGDGIPERFSGSGSGTNRFLSISNVQPEDEADYFCQSDYYPGGS
YVSTQ
Download sequence
Identical sequences F6Q3Z2
ENSMODP00000015619 ENSMODP00000015619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]