SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015723 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000015723
Domain Number - Region: 3-132
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00818
Family DBL homology domain (DH-domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015723   Gene: ENSMODG00000012565   Transcript: ENSMODT00000016013
Sequence length 168
Comment pep:known_by_projection chromosome:BROADO5:1:459975545:459984344:1 gene:ENSMODG00000012565 transcript:ENSMODT00000016013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVKELLRNIEQTYRLFQQQQFTFIAALEHCRENAHDKIRPITSIGQVQNYMEHYCNNS
TDHRILQMFLKICTELNRLCQQFENLHPGTPTTNNILEKCKILVSHSNDLSSLRARYPHD
VVNHLSCDEARNHYGGVVSLIPITVDLMKEWIAHSEKLPRKAAQHGAT
Download sequence
Identical sequences F6PLC3
ENSMODP00000015723 XP_007475268.1.35504 ENSMODP00000015723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]