SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015725 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015725
Domain Number 1 Region: 484-605
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-24
Family SH2 domain 0.00052
Further Details:      
 
Domain Number 2 Region: 609-648
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000126
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015725   Gene: ENSMODG00000012566   Transcript: ENSMODT00000016015
Sequence length 675
Comment pep:known_by_projection chromosome:BROADO5:2:199559275:199598677:-1 gene:ENSMODG00000012566 transcript:ENSMODT00000016015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGAELRDGEAAAAAAAAAAASYRVLSRLLGYGESASEPAPPPLPPPAPGHGPQPLPPTQ
SPVPPPPPPPFLPRPGPRGSRPPQLMVFRNVGRPPEEEEAAAAAGPGPGPSELLCPRHRC
TLDPKALPPGLGLGLGLGLERGWGPAAAAAAAAGLEAHLAALGLGPAGKGPGPAGGSCPC
APQPSAPQAQLPVAAPQSGEDPTETSDALLVLEALESEAESLETNSCSEEELSSPGRGAG
GGGGVGRHASLQPLTPELLPAPFPLQDLVPPGRPSRVEPQPPPQQQPPAAPLRPPLGTSR
KGSLRIRLSRLFRTKSCNGASAGGDMAGKRPPGELAASSVSLTDVGGPRAGESEAARKPR
LTRTQSAFSPVSFSPFFTGETVSLVDVDISQRGLTSPHPPTPPPPPRRSLSLLDDISGTL
PTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIVPIRATESLHNQPTQHLQCPLYRPDSS
SFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHH
TRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLL
YPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYYDPQEEVYLSLKE
AQLISKQKPEVEPST
Download sequence
Identical sequences F6PLA6
ENSMODP00000015725 ENSMODP00000015725 XP_001366804.2.35504 XP_007482395.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]