SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015944 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015944
Domain Number 1 Region: 329-541
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-59
Family DBL homology domain (DH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 524-685
Classification Level Classification E-value
Superfamily PH domain-like 4.88e-33
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 
Domain Number 3 Region: 708-872
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-23
Family Pleckstrin-homology domain (PH domain) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015944   Gene: ENSMODG00000012742   Transcript: ENSMODT00000016238
Sequence length 875
Comment pep:known_by_projection chromosome:BROADO5:8:8633503:8829865:1 gene:ENSMODG00000012742 transcript:ENSMODT00000016238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEGSANFRRVAIRRKSKEPSLLAATPRPWSRPTAHLESRSLPLGVPGSSSCPKILVVS
SPCPSSKTDASVHQNVCDEAQGINGKAPVKASASSAAHPKPQVPPKPLHLQNSPSSNQFQ
TPKHKTFPSVKPRMEEVKPVPAFISKEKPSKVSDLISRFEGGSSSSNSSDLKKELSVSQT
VSKAQGRHGLTTALQPKLLSQHPLQKQESNTDQTQDVQKHTANGVIGAQKEMECEDSKFP
AVSPDTSNQTLEPSLPNSLANGEKDRTAANSSFPTTDICKGSALSSCCRTSSRNPLLLLE
KEHTEMKPPEEEKDEESPLELEKQDLSIETKETDEQKLHKIATELLLTERAYVNRLDLLD
KIFYCQLLEEANRGSFPAEMVNKIFSNISSINAFHSKFLLPELEKRMQEWETTPRIGDIL
QKLAPFLKMYGEYVKGFDHAMELVKSMTERMPQFKSVVEEIQKQKICGNLTLQHHMLEPV
QRIPRYELLVKDYLRTLPPDSPDWKDAKKSLEIISTAASHSNSAIRKMENLKKLLEVYEM
LGEEEDIVNPSNELIREGQILKLAARNTSAQERYLFLFNNMLLYCVPKFSLVGSKFSVRT
RVGIDGMKIVETHNEEYPHTFQVSGKERTLELQASSEQDKEDWIKALQNTIEAFHQRHET
FRNAIAKDNDIHLEVSTAELGKRAPRWIRDNEVTMCMKCKESFNALTRRRHHCRACGHVV
CWKCSDYKAQLEYDGGKWNKVCKDCYQIITGCTDSEEKKRKGILEIESAEVSGNSVICSF
LHYMEKSKPWQKAWCVIPKQEALVLYMYGAPQDVRAQATIPLLGYMVDDTPKSADLPHSF
KLTQSKSVHSFSADSEEMKQKWLKIIHLAVKEQRI
Download sequence
Identical sequences F6T152
ENSMODP00000015944 ENSMODP00000015944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]