SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016034 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016034
Domain Number 1 Region: 247-403
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.96e-32
Family DnaQ-like 3'-5' exonuclease 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016034   Gene: ENSMODG00000012817   Transcript: ENSMODT00000016331
Sequence length 425
Comment pep:known_by_projection chromosome:BROADO5:1:460705191:460718384:-1 gene:ENSMODG00000012817 transcript:ENSMODT00000016331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVKAGLSKPSKGSVVARPEFVKKSDRKKQKKKKKFWKKYPQAATEASKNPECKDARAAA
ALPPKGPQEFSHNWKALQELLKQKTLVPENSLPVFQGNSRKQPKDHHQNGKHVLKKEEYG
DTELPELPGKIGQPSSKALISLGSLNDTKVASHKKCSETKGKGSGTDTKKRKNGSLHQKI
VDIKREKRKAELVPPPPTEADIWFDDVDPKDIEAAIGPEAAEIARKKLGLKETNLSLVKE
RAFEGMTKAVAMDCEMVGAGPNGEENILARVSIVNQFGKCVYDKYVKPTEKVTDYRTDVS
GIRPEDIKHGEKFKVVQKEVADLLKDRILVGHALHNDLKILLLDHPKKKIRDTQKYKPFR
TQVKTGRPSLKLLSQKILGIRIQQSEHCSIQDAQAAMRLYVMVKKQWEGTIKDKYKLQRE
KNGKA
Download sequence
Identical sequences F7DY31
XP_001371704.2.35504 ENSMODP00000016034 ENSMODP00000016034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]