SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016256 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016256
Domain Number 1 Region: 376-389,420-626
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 9.82e-36
Family Cofactor-dependent phosphoglycerate mutase 0.029
Further Details:      
 
Domain Number 2 Region: 16-78
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000102
Family UBA domain 0.00028
Further Details:      
 
Domain Number 3 Region: 247-311
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000614
Family SH3-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016256
Domain Number - Region: 83-210
Classification Level Classification E-value
Superfamily LigT-like 0.000398
Family Atu0111-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016256   Gene: ENSMODG00000012999   Transcript: ENSMODT00000016556
Sequence length 640
Comment pep:known_by_projection chromosome:BROADO5:4:225395754:225576412:-1 gene:ENSMODG00000012999 transcript:ENSMODT00000016556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAREELYSKVIPRRNRQQHRPGTIKHGSALEVLLSMGFPKARAQKALASTGGRSVQAAC
DWLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKAHNIFPHITLC
QFFMCEDSKVDALGEALQATVMRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEILKKFAA
DFAAEAASKTEVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNIDVKLGCDWVATIFSRD
IRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTSLTTGCSGLLP
ENYITKADECSTWIFHGSYSILSTSSSSGSLMFSDGILERRQQEEQGPGDTSPLTIICQP
MQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRS
GGFRDYEKDAPITVFGCMQARLVGEALLESNTIVDHVYCSPSLRCVQTAHNILKGLQQEN
HLKIRVEPGLFEWTKWVAGNTLPAWIAPSDLAAANLSVDTTYRPHIPVSKLVISESYDTY
ISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLG
FCSCEELGETGVWQLTDPPILPLTHGPTGGFNWRETLLQE
Download sequence
Identical sequences F7C8N8
ENSMODP00000016256 ENSMODP00000016256 XP_007494683.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]