SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016281 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016281
Domain Number 1 Region: 7-113
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.82e-25
Family Canonical RBD 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016281   Gene: ENSMODG00000013020   Transcript: ENSMODT00000016581
Sequence length 205
Comment pep:known_by_projection chromosome:BROADO5:4:360453296:360467291:-1 gene:ENSMODG00000013020 transcript:ENSMODT00000016581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYFFTFE
DVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRS
RSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNS
RSRSKSQPKKEMKAKSRSRSRRHVA
Download sequence
Identical sequences F7BP58
ENSMODP00000016281 ENSMODP00000016281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]