SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016293 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016293
Domain Number 1 Region: 568-656
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-18
Family Third domain of FERM 0.007
Further Details:      
 
Domain Number 2 Region: 382-475
Classification Level Classification E-value
Superfamily PH domain-like 4.48e-16
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 3 Region: 273-322
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000131
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 532-567
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000017
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016293
Domain Number - Region: 16-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00843
Family Ubiquitin-related 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016293   Gene: ENSMODG00000013030   Transcript: ENSMODT00000016594
Sequence length 679
Comment pep:novel chromosome:BROADO5:1:283523428:283653023:-1 gene:ENSMODG00000013030 transcript:ENSMODT00000016594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPKDPTKKKKKKQDDQSEDEALELEGPLITPGSGSIYS
SPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQ
ALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQSKW
AILLEEIECTEEEMMMFAALQVGERNDLIQYCDLNLLLEKEVDEVDAALSDLEITLEGGK
TSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESGGTSVQQM
NLRGCQITPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMA
DSSYNLEVQNILSFLKMQHLNPDPQLIPEQVTTDINPECLVSPRYLKKYRNKQITARILE
AHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASNG
DAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAK
DQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences F7BNK8
13616.ENSMODP00000016293 ENSMODP00000016293 ENSMODP00000016293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]