SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016382 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016382
Domain Number 1 Region: 43-149
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.29e-23
Family Canonical RBD 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016382   Gene: ENSMODG00000013089   Transcript: ENSMODT00000016684
Sequence length 241
Comment pep:known_by_projection chromosome:BROADO5:4:361127555:361159598:1 gene:ENSMODG00000013089 transcript:ENSMODT00000016684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRDAMKSWSDSQSDLYSSDQEEEEEMIFGENEDDLEEMMDLSDLPTSLFACSVHETVFE
VQEQKERFEALFTLYDDQVTFQLFKSFRRVRINFSKPEAAARARIELHETDFDGKKLKLY
FAQVQMSNEPGDKAYLLPPQPVKQFLISPPASPPVGWKQGEDAMPVINYDLLCAVSKLGP
GEKYELHAGTESTPSVVVHVCESETEEEEEVKNPKQKIAPTRRPEAPSMIRNEPHTLGCT
L
Download sequence
Identical sequences F7EXQ5
XP_001366182.1.35504 XP_007491371.1.35504 XP_007491372.1.35504 XP_016277575.1.35504 ENSMODP00000016382 ENSMODP00000016382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]