SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016438 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016438
Domain Number 1 Region: 370-558
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.05e-64
Family Regulator of G-protein signaling, RGS 0.00000769
Further Details:      
 
Domain Number 2 Region: 767-996
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-63
Family DBL homology domain (DH-domain) 0.00000000111
Further Details:      
 
Domain Number 3 Region: 1000-1130
Classification Level Classification E-value
Superfamily PH domain-like 8.41e-39
Family Pleckstrin-homology domain (PH domain) 0.00000157
Further Details:      
 
Domain Number 4 Region: 69-149
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-21
Family PDZ domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016438   Gene: ENSMODG00000013134   Transcript: ENSMODT00000016741
Sequence length 1539
Comment pep:known_by_projection chromosome:BROADO5:4:228530028:228757564:-1 gene:ENSMODG00000013134 transcript:ENSMODT00000016741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGTQSTITDRFPLKKPIRHASILTRESPTDKKQKVERSTSHDIDPTDSSSKKTKSSSEE
SRSETYGLVQRCVVIQKDDNGYGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVEPAAFGHMSPIMTSPHSPG
TSGNTERITSPVLMGEENNVVHSQKVEILRKMLQKEQERLQLLQEDYSRTPAPRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGTVVLPSKSSGDSFLLSEVEADSGDGLGRIDCSSGDGS
RPNSDIADSPRGGLKERIYLEESPEKNEMMQDNDTQSNIGSPLIRTAPQIIGAEDDDFGT
EHEQINGQCSCFQSIELLRSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRR
IFLEFHQFFLDRSAHLKVSVPDEISLDLEKRRPELIPEDLHRHYVQTMQDKVYPEVQKHL
EDFRQKRSMGLTLAESELTKLDAERDRDRVTLEKERACAEQIIVKIEEVLMTSQAVEEDK
SSTMQYVILMYMKHLGVRVKEPRNLEHKRGRIGFLPKIKQSIKKDKEGEEKVKRRGFPSI
LGPPRRPSRHDSSAISRAMELQKQRHPKHLSTPSSMSPEPQDSVKLRQSGIATDVADVMY
MPANSISSLTSGTSASQEGGKENEIGSKSIGEAPGSGDSTDGTPRTPNTVFDFPAPPLDQ
LQEEEGEVERLPEHGTPKTFRKLDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSSSELRRIFSNLEEILQ
LHIGLNEQMKAVRKRNETSVIDEIGEDLLIWFSGAGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTERPKEREKV
KKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSNLKLSEYPNVEELRNLDLTKRKM
IHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLNTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKAVWQDLIGRMALSVKEQSTK
PIPLPESPPCEGEHDEEEASKLKEESHGVSTSSLQSPEKHMGAEISLMSKPQSSSSVTSG
KSEISDILAERQFEKEQQAEETLKESEMDYQSTVPEPHFPVSEERWALDALRNLGLLKQL
LVQQLDLTEKKTHEDWQHFPRFRAASQGVQVKCPDTIQNVLDHSENNKTSQPCEGQMPLQ
TRTGETAACYSPRTSIESPIPQDYMELASQNSRASNLLVMDHMITTPEPSSTELEGGPDD
SGEHFFDAREVHSDDNPSESDGIERKEEETVQLRISGNVLILDGYETVQESSTEEDVVPG
LPAMGWAHQQQPLRDARSDGGGSPFTSEYLIQPRWGPVEEFGFSAQSPPSSTDSHSQIMQ
YIGKIEADLEHLKKVEESYMTLCQRLAGSALTEEHSDKS
Download sequence
Identical sequences F7B035
ENSMODP00000016438 XP_007494698.1.35504 ENSMODP00000016438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]