SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016525 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016525
Domain Number 1 Region: 110-218
Classification Level Classification E-value
Superfamily Second domain of FERM 4.06e-29
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 2 Region: 222-362
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-23
Family Third domain of FERM 0.0026
Further Details:      
 
Domain Number 3 Region: 16-110
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.79e-16
Family First domain of FERM 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016525   Gene: ENSMODG00000013207   Transcript: ENSMODT00000016829
Sequence length 570
Comment pep:known_by_projection chromosome:BROADO5:1:280634102:280759110:-1 gene:ENSMODG00000013207 transcript:ENSMODT00000016829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKVLCHQLLVQVCDLLRLKDCHLFGLS
VIQNNEHVYMELSQKLYKYCPKEWKKEASKGIDQFGPPMIIHFRVQYYVENGRLISDRIA
RYYYYWHLRKQVLHSQCMLQEEAYFLLAAFALQADLGNFKRNKHYGKYFEPEAYFPSWVI
TKRGKDYILKHIPNMHKDQFALTASEAHLKYIKEAIRLDDIAVHYYRLYKDKREIEASLT
LGLTTRGIQIFQNISEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKLIYYTGCPM
RSRHLLELLSSSHRLYMNLQPVLRHIRKLEENEEKKQYRESYISDNLDFDMDHLEKRSQA
SGSSSGSMKHKRFSRHSTTSHSSSQTSGIETDTKIRDIVPEDIFLSSTIYHRLKTCSSMT
SHDSSHTSGVESGGKDRLEDDSQDDGLIVKEISSSTSGSSETVVKLHGQSTDSLPQATYR
KPKTSSDRHSLSLDDIRLYQKDFLQIAGLCQDTAQSYTFGCGHELDEEGLYYNSCLAQQC
INIQDTFPVKRTSKYFSLDLTHDEIPEFVV
Download sequence
Identical sequences F7EWG6
ENSMODP00000016525 ENSMODP00000016525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]