SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016553 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016553
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.18e-51
Family N-terminal domain of cbl (N-cbl) 0.000000582
Further Details:      
 
Domain Number 2 Region: 200-286
Classification Level Classification E-value
Superfamily SH2 domain 1.87e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 292-370
Classification Level Classification E-value
Superfamily RING/U-box 5.52e-43
Family RING finger domain, C3HC4 0.00000906
Further Details:      
 
Domain Number 4 Region: 114-199
Classification Level Classification E-value
Superfamily EF-hand 1.94e-38
Family EF-hand modules in multidomain proteins 0.00000543
Further Details:      
 
Domain Number 5 Region: 789-838
Classification Level Classification E-value
Superfamily UBA-like 0.00000817
Family UBA domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016553   Gene: ENSMODG00000013232   Transcript: ENSMODT00000016858
Sequence length 851
Comment pep:known_by_projection chromosome:BROADO5:4:230626157:230718432:-1 gene:ENSMODG00000013232 transcript:ENSMODT00000016858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGRMETLGENEYFRVFMENLMK
KTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKA
DAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIF
TRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWA
IGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVT
QEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESEGQGCPFCRCEIK
GTEPIVVDPFDPRGGGGLLRQGAEGAPSPNYDDDDDERADDSLFMMKELACAKVERPPSP
FSMAPQASLPPVPPRLDLLQQRTSNPSGASSPGTSSKTTPGSLHKDKPLPIPPTLRDLPP
PPPPDRPHSIGAESRPQRRPLPCTPGDCPSRDKLPPVPSGRPGESWLPRPIPKVPTATLS
PGDPWSGRELTNRHSLPFSLPSQMDPRTDGLRHGSTFSLDAPVNMNNNPLVGPECEHPKI
KPSSSANAIYSLAARPLPVPKLPLGEQCGNDEDTEYMSPSSRPLVLPVVNLQKIDVKRPL
ETTHSLHVFDSEQQVDSCTYEAMYNIQSQATSGLEISTSVEGDLATTLASNGPEESENED
DGYDVPKPPVPAVLARRTLSDISNASSSFSWMSLDGDPTTGFTEGSQVPERPPKPFPRRI
NSERKAGSCQQAGAAPSTSPQLSSEIESLMSQGYSYQDIQKALVIAHNNIEMAKNILREF
VSISSPAHVAT
Download sequence
Identical sequences F7ECX4
13616.ENSMODP00000016553 ENSMODP00000016553 ENSMODP00000016553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]