SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016657 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016657
Domain Number 1 Region: 101-206
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-35
Family Second domain of FERM 0.0000515
Further Details:      
 
Domain Number 2 Region: 204-348
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-31
Family Third domain of FERM 0.00051
Further Details:      
 
Domain Number 3 Region: 9-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-19
Family First domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016657   Gene: ENSMODG00000013316   Transcript: ENSMODT00000016962
Sequence length 640
Comment pep:known_by_projection chromosome:BROADO5:6:728938:850247:1 gene:ENSMODG00000013316 transcript:ENSMODT00000016962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCFCAVPEDFYCEVLLLDESKLTLTTQQQGVKKSTKGSVVLDYIFHHINLVEIDYFGLR
YCDRNHQTYWLDPAKTLAEHKELIHAGPPYTFYFGIKFYAEDPCELKEEITRYQFFLQVK
QDVLQGRLPCPGHVAAQLGAYALQAELGDYDPHKHPPGYVSEYRFVPDQKEELEDAVERI
HKTLMGLVPSEAEIKYLATVKSLEMYGVDLHPVYGEGRSDYFLGLTPVGVVVYKDRRLVG
KYFWPRITKVHFKETQFELRVLGKDCTETSFFFETSSKSVCKHLWKGCVEHHTFFRMPEE
ESGSLARKLSKLGSLSHKHRSRIALQMGRDRSVPLPRPDQKVERSRSKTYPKRIAQTQPS
GSNSINRVTEGAENGGTTKIIAPLPVQSFKKSEGENSPETPTSKASAPWEENGAQGGLYN
CSSDRKRSPKFPSARRRSPSGSSDPEPGQPARRRQKSRNSGDDSDLKLRRRSRSRCNTSS
GSESEHSKREHQKKRNRFRQENGVTDSAPQWEAALQHPKEKPEANSNSRRSRHRSRSRSP
DFQAKEELWRHIRKELVDPSGLSEEQLKEIPYTKIETHGDPVRVRPCRSPRSRRQYRRSQ
GSDGERSALSDRNAKTDLVPPLPVTRPSDSQCFSGSTSYQ
Download sequence
Identical sequences F6YVJ3
ENSMODP00000016657 ENSMODP00000016657 13616.ENSMODP00000016657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]