SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016701 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016701
Domain Number 1 Region: 413-563
Classification Level Classification E-value
Superfamily TRAF domain-like 2.62e-50
Family MATH domain 0.0000000357
Further Details:      
 
Domain Number 2 Region: 363-412
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 6.54e-21
Family Trimerization domain of TRAF 0.0000984
Further Details:      
 
Domain Number 3 Region: 111-210
Classification Level Classification E-value
Superfamily TRAF domain-like 5.69e-18
Family SIAH, seven in absentia homolog 0.014
Further Details:      
 
Domain Number 4 Region: 41-98
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000514
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 5 Region: 211-252
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000785
Family SIAH, seven in absentia homolog 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016701
Domain Number - Region: 269-409
Classification Level Classification E-value
Superfamily Tropomyosin 0.00314
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016701   Gene: ENSMODG00000013357   Transcript: ENSMODT00000017011
Sequence length 567
Comment pep:known_by_projection chromosome:BROADO5:1:313588490:313651828:-1 gene:ENSMODG00000013357 transcript:ENSMODT00000017011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSKKMDPPNPLQTVQQKANPDRGAAVSIYVPEQGGYKEKFVKPVEDKYKCEKCHLILC
NPKQTECGHRFCETCMHVLLSAPSPKCTACQENIIKDKVFKDNCCKREILALQIYCRNES
RGCTEQLTLGHLLVHLKSECQFEELPCVRADCKEKILRKDLQDHVEKSCKYREATCQYCK
SQVPMITLQKHEDTECPCVVVSCPHKCSVQTLLRSELNAHLSECINAPSTCSFKRYGCTF
QGTNQQIKTHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIE
IERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRV
TELESVDKSAGQAARNTGLLETQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWK
IRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGE
YDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT
VLENGTYIKDDTIFIKVIVDTSDLPDP
Download sequence
Identical sequences F7DTX9
XP_007473594.1.35504 ENSMODP00000016701 13616.ENSMODP00000016701 ENSMODP00000016701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]