SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016781 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016781
Domain Number 1 Region: 222-322
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.82e-19
Family Canonical RBD 0.0000644
Further Details:      
 
Domain Number 2 Region: 459-588
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.8e-17
Family Canonical RBD 0.0055
Further Details:      
 
Domain Number 3 Region: 333-425
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.96e-16
Family Canonical RBD 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016781
Domain Number - Region: 624-702
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000285
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016781   Gene: ENSMODG00000013418   Transcript: ENSMODT00000017093
Sequence length 723
Comment pep:novel chromosome:BROADO5:4:382860122:382874981:-1 gene:ENSMODG00000013418 transcript:ENSMODT00000017093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIDGGGASAARRQISRPVLKKGHGQALSDLTLLPGGNEPGARTKEEGQGAMVQRRPIQV
HLSGRGGGTRAGVTGSGTNKDAEGAGRGCSPYREGAAGDGRVPPPMRGGGRRVRAAMSRR
LLPRAEKRRRRQEQRQQLEEPQEHQEPQQLQRRRRRAAGAMVKMAAAGGGGGGGRYYGGG
GGGGGGGSEGGRAPKRLKTENAGEQHGGGGGGAGAAGGGGGGGENYDDPHKTPASPVVHI
RGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDILGACNAVNYAADNQIYIAG
HPAFVNYSTSQKISRPGDTDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVI
FRKNGVQAMVEYPWLLDAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT
NPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMG
PPVGGHRRGPSRYGPQYGHPPPPPPPPEYGPHADSPVLMVYGLDQSKMNCDRVFNVFCLY
GNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQQAIMPGQSYG
LEDGSCSYKDFSGSRNNRFSTPEQAAKNRIQHPSNVLHFFNAPLEVTEDNFFEICDELGV
KRPASVKVFSGKSERSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQ
HAS
Download sequence
Identical sequences F7CN94
ENSMODP00000016781 ENSMODP00000016781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]