SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016878 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016878
Domain Number 1 Region: 118-151
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000497
Family CCCH zinc finger 0.00037
Further Details:      
 
Domain Number 2 Region: 154-184
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000693
Family CCCH zinc finger 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016878   Gene: ENSMODG00000013494   Transcript: ENSMODT00000017191
Sequence length 361
Comment pep:known_by_projection chromosome:BROADO5:4:383094371:383098044:1 gene:ENSMODG00000013494 transcript:ENSMODT00000017191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGSATSGGKPKSASMDLCALYEKLLSLNPVASATRGELELEPELGWASRSPWSNLTDLE
PAASPPRPSDPPTLRPPGRSTSLVEGRSWVPPPPGFEPLPPRAGPVPSEGAAGAASSSRY
KTELCRTFSESGKCRYGSKCQFAHGPGELRPASRHPKYKTELCRKLLILGSCPYGSRCHF
IHYPSDFLSGAVAHPPPLRQSLSFSGVPSARRRGSPTLSPPGLPDLPFPLGFSSPPSSPP
PLATAPGDLLFLPSAFSAAPGQVPRGATAGEACCPSCRQSTGSWGPVRDALGLGLARSPS
AHSLGSEPDDQASSGGSSLGGSDSPVFEVAVGGAFAPSNSHLLAPAPTRRLPIFNRLSVS
D
Download sequence
Identical sequences F7F8R7
XP_007491871.1.35504 ENSMODP00000016878 ENSMODP00000016878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]