SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016879 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016879
Domain Number 1 Region: 53-308
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-98
Family Protein kinases, catalytic subunit 0.00000975
Further Details:      
 
Domain Number 2 Region: 715-825
Classification Level Classification E-value
Superfamily KA1-like 1.8e-47
Family Kinase associated domain 1, KA1 0.00000349
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016879
Domain Number - Region: 327-365
Classification Level Classification E-value
Superfamily UBA-like 0.0218
Family UBA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016879   Gene: ENSMODG00000013489   Transcript: ENSMODT00000017192
Sequence length 825
Comment pep:known_by_projection chromosome:BROADO5:1:312562100:312699790:-1 gene:ENSMODG00000013489 transcript:ENSMODT00000017192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRTPLPTVIERDTENHTSHGDGRQEVTSRTGRSGARCRNSVASCADEQPHIGNYRLLK
TIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFE
VIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLK
AENLLLDADMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLG
VILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPTKRGTLEQ
IMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITAT
YLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSISSSQKQRRYSD
HGEGLSYTKKDVIQSNFQAGPSIPPVVAYPKRSQTSTTDNDLKEEGIQPRKSSSSAVGGK
GLAPASPMLGNANNPNKADIPERKKSATIPSNNSTSGGMTRRNTYVCSERTTADRHSVIQ
NGKENSLTEMFAYAASPASLCTTSSTCIRLRHQKSMSMSASGQPKMMLPPIDSEGDNFKD
ITVPDQRTPVASTHSISSATTPDRIRFPRGTASRSTFHGQPRERRTATYNGPPASPSLSH
EATPLSQTRSRGSSNLFSKLTSKLTRRNMSFRFIKRLPTEYERNGRYEGSSRNVSAEHKD
ENKEAKPRSLRFTWSMKTTSSMDPNDMMREIRKVLDANNCDYEQRERFLLFCVHGDGHAE
NLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Download sequence
Identical sequences F7F8R2
ENSMODP00000016879 ENSMODP00000016879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]