SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016937 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016937
Domain Number 1 Region: 107-195
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.93e-19
Family DBL homology domain (DH-domain) 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016937
Domain Number - Region: 315-381
Classification Level Classification E-value
Superfamily PH domain-like 0.000142
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016937   Gene: ENSMODG00000013533   Transcript: ENSMODT00000017250
Sequence length 827
Comment pep:known_by_projection chromosome:BROADO5:4:383102645:383110295:1 gene:ENSMODG00000013533 transcript:ENSMODT00000017250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGAHSLSLSKPSPSPSSGCNHRACGLLLSPAWSLLLQASPALPMASPRGSGSSTSLSTVG
SEGEPHAGPSPGPSSGQACSGPALEPLPGPPIQLHLTPVGPRGEPGQGTRKPSHLERVAR
EIVETERAYVRDLRSIVEDYLGCLVANGPPGLTSEHLGTLFSNIEDIYEFSSELLEDLES
SSSTHSIADCFVQRVSAAPARDSLTEVMVGRRSWEGVEHGLDPAQVLTGGGIPEGGGAPL
GSGGALGGWKLEGQSAGRRKSILHPLKREAKRLDLRMPGARDGLQSLGFGGPGGYEAWRL
DLFPPAALQCCNLSVSESSKDPLSFKVADVTIPKHQHLLQDKNHEEKRLWLHYLHRLIVE
NHPASIPAKAKQVLLENTFHCAPEGQPSCEPLTPPLGSPRLPEGRNFTGRRTTDPSPSLS
SPAGASPGRRGRRQSEPAKESHIMLPQIAGSRLKHAGSEGELFPKSEPLCKAPTPEPALV
LASGTPEDLEEPAPPNLGPPGLSITEEIMELLTQRGLQESGLPPVDVPEAPQFQGEPECP
SHSGNVGPESPAPPSTESSEEAEGKQLGDRAPSPLHVLEGPDSPEISSIPEIPGTAAISA
IPQLPDISQIPSCEDSPQISDHSLEQGEPCPQGAVQDGDSSGKTIPAEKTHDGAEPRQDS
QLRRRALSHTGDLEAPAFHSCSEIRRAWRAMEQGAMEGRSSQGSILEPLLILEESDFRGN
CRVGGGSAGSERVATRVRELARMYSDRIERLQRAGNQACVAGSRRRTRGLVHSHQLLVPP
KEEEELRPGPPPVFGHVLVREVSLPMTCAQASVALVPAVRAQAAAPL
Download sequence
Identical sequences F7CMH9
ENSMODP00000016937 ENSMODP00000016937 13616.ENSMODP00000016937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]