SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017114 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017114
Domain Number 1 Region: 269-337
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000259
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 2 Region: 144-236
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00000196
Family Transhydrogenase domain III (dIII) 0.01
Further Details:      
 
Domain Number 3 Region: 53-76
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000222
Family CCCH zinc finger 0.0047
Further Details:      
 
Domain Number 4 Region: 81-105
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000549
Family CCCH zinc finger 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017114
Domain Number - Region: 362-390
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00131
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017114   Gene: ENSMODG00000013686   Transcript: ENSMODT00000017431
Sequence length 478
Comment pep:novel chromosome:BROADO5:8:202742303:202779726:-1 gene:ENSMODG00000013686 transcript:ENSMODT00000017431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAAPGTTATTSGAAAAAAVAAASPTLTPTVASQSPAAGGGGGGSGGGWTKQVTCRYF
MHGVCKEGNNCRYSHDLSTSQSAMVCRYYQRGCCAYGDRCRYEHTKPLKREEVTAANLAA
KPDPPASSSLPTLVETLAEASTGEAETENSNFAAAGAGGEDWVNAIEFVPGQPYCGRAAP
SCTEAPLQGMVIEEELEKQQTNVEMKKQLCPYAAVGECRYGENCVYLHGDACDMCGLQVL
HPVDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFGILSN
CNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLIQKYKEA
MSNKPCRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSNRYRAQRRNRFWELIE
ERESSNPFDNDEDEVVTFELGEMLLMLLAAGGDDDLTDSEDEWDLFHDELEDYYDLDL
Download sequence
Identical sequences F6QPR3
ENSMODP00000017114 ENSMODP00000017114 XP_001368017.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]