SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017146 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017146
Domain Number 1 Region: 585-767
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.22e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.073
Further Details:      
 
Domain Number 2 Region: 458-553
Classification Level Classification E-value
Superfamily WWE domain 4.05e-16
Family WWE domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017146
Domain Number - Region: 274-297
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0011
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number - Region: 93-137
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00754
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017146   Gene: ENSMODG00000013713   Transcript: ENSMODT00000017464
Sequence length 768
Comment pep:known_by_projection chromosome:BROADO5:8:202310601:202367926:-1 gene:ENSMODG00000013713 transcript:ENSMODT00000017464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGAPVVTGGAVVAWCRRSRAAARLSRHIPVSFRSWPRLSSAGAGRAPISEARLVRARA
SSAAENSAGAQARGGYLTMAQGAIGRLITQELCAAGGSLDLGELVRRLPGGISEDALEKT
LRKLYEKRFVLRTRSEDSEEGARGAGGGRGGGGGDGGPERRPVIVVVAASDVRLCQAYSS
VCDGNCGQLHLCKFFLYGTCKFNNSRKPCKYSHTINNLHNVIILKNLGIEDLQVDELCQL
LLQNDPSLLPEICAYYNKGDGQYGACTFKKTCVKLHLCQYYLQGNCRFGSSCKRAHDFSH
ECREKLRKCGIDSAAISKLLSTYRNAFDIKNGNSAPQKGLLVCYISLSFAERKQSGDSAS
NASEESDQICLYHIREACCFKDKCFKVHFHLPYRWQFFDGNTWKDSQDMEKIEKAYCDPT
RNQYEMCMASIDYPFFSASLPFDDMRIGPYKFRRLSTVSSVLKPPHFVLTTDWLWYWEDE
AGRWQEYGAKGMDHHAATVSSADVEKAYLSQESPVLLFSARKYRYELDFKAMTQKNLDIG
TVRSVRRRPKYVSPEEVKIKRSCGDKLHVPKDIPSYWDTSALPDLGFKSIPLPSSSEEYQ
TVQNQFFRTLPSYTIHKIERIQNPSLWEVYQWYKVQMKKSNGGQEVAEKFLFHGTSPEYV
DAICHQNFDWRICGLHGTSYGKGSYFARDAAYSHHYSKATQGLQPMFLARVLVGDYTRGS
SSYLRPPPKEGQRNVFYNSCVNSLLNPSIFVIFEKQQIYPEYLIWYSS
Download sequence
Identical sequences F6Y9D5
ENSMODP00000017146 ENSMODP00000017146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]