SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017236 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017236
Domain Number 1 Region: 106-361,783-846
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-95
Family Protein kinases, catalytic subunit 0.0000101
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017236
Domain Number - Region: 379-425
Classification Level Classification E-value
Superfamily UBA-like 0.0729
Family UBA domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017236   Gene: ENSMODG00000013784   Transcript: ENSMODT00000017555
Sequence length 1414
Comment pep:known_by_projection chromosome:BROADO5:4:233557064:233861581:1 gene:ENSMODG00000013784 transcript:ENSMODT00000017555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGAGRRGRPASLSDVYPASPSFPAPLPPSRLPAVPEVSLHNKMAAAAASGAGGTAGAG
AGGVCPAARLLPPAAAGPPAAPAPVPSTGPPRPPAPAPRGPLPARIGYYEIDRTIGKGNF
AVVKRATHLVTKAKVAIKIIDKTQLDEENLKKIFREVQIMKMLCHPHIIRLYQVMETERM
IYLVTEYASGGEIFDHLVAHGRMAEKEARRKFKQIVAAVHFCHCRNIVHRDLKAENLLLD
ANLNIKIADFGFSNIFTPGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIWSLGVVLYVLV
CGALPFDGSTLQNLRARVLSGKFRIPFFMSTECEHLIRHMLVLDPSKRLSMEQICKHKWM
KLGEADPNFERLISECQHLKVERQMEPLNEDVLLAMVEMGLDKERTLQSLRTDAYDHYSA
IYSLLCDRLKRHKNLRIGAPPSVPRTMTFPAPAAIQAEQAGTTVSINVPQVQLINPENQI
VETDGTMNLDSDEGEEPSPEALVRYLSMRRHTVGVADPRTEVTEDLQKLLPGFPRVSPQA
PFLQVAPNMNFVHNLLPMQNLQPTGQLEYKEQSLLQPPTLQLLNGMGPLGRRASDGGANI
QLHAQQLLKRPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEAVQRYLANRSKRHTLAMT
NPTAEIPPDLQRQLGQQPFRARVWPPHLVPDQHRSVYKDSNTLHLPTERFSPVRRFSDGA
ASIQAFKAHLEKMGNHSSIKQLQQECEQLQKMYGGQIDERTLEKTQQQHMLYQQEQHHQI
LQQQIQDCIRPPQPSPPLQATCENQPALLTHQLQRLRIQPSSPPPTHPNNHLFRQPSNSP
PPVSSAILQSHGAASPSQFQGLPSRSAIFQQPGNCSPPPNVTLTCMGLQQPAQSQQVTIQ
VQEPPDMLSNMPGASAAGRGMSLNSCASQIQMQHRANLMASLTYGHRPLSKQLSADSAEA
HSLNMNRFSPANYDQAHLHPQLFSDQSRASPTSYSPSAGVGFPPTQALKVPPLDQFPTFP
SSAHQQQQHYTTSALQQALLSPTPPDYPRHQQVPHILQGLLSPRHSLTGHSDVRLPPAEF
AQLIKRQQQRQQQQELQELFRHMNQGDAGSLASSLGGQSISECQALSLPYQNTDSYHHHH
HHHHHHHHHTSPQHLLQIRAQECISQVPSPAPAHGYAHQPALIHSESMEEDCSCEGARDC
FPDSKSSNTLTKGCHESPLLLNTGGPGDPESLLGTVSHAQEMGVHPYRHQPVTGFSRNKV
PSRESVIGNCMDRSSAGQAMELPDHNGLGYSTRSTVNEHHRPRTLQRHHTIQNSDDAYVQ
LDNLPGMSLMAGKALSSARMSDAVLSQSSLMGSQQLQDRESEGCRETLEGQEPSDLTDGS
QHLHNSCYPSTCITDILLSYKHPEVSFSMEQAGV
Download sequence
Identical sequences F6TUU1
ENSMODP00000017236 ENSMODP00000017236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]