SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017391 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017391
Domain Number 1 Region: 3-140
Classification Level Classification E-value
Superfamily NTF2-like 4.68e-36
Family NTF2-like 0.0027
Further Details:      
 
Domain Number 2 Region: 339-454
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.99e-16
Family Canonical RBD 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017391   Gene: ENSMODG00000013903   Transcript: ENSMODT00000017713
Sequence length 477
Comment pep:novel chromosome:BROADO5:8:197960118:198161964:-1 gene:ENSMODG00000013903 transcript:ENSMODT00000017713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKEMVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYG
QKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQAFRRFMQTFVLAPE
GSVANKFYVHNDIFRYQDEVFGGFITEPQEESEEEVEEPEERQQTPEVVPDDSGAFYDQT
VSNDLEEHLEEPVVEPEPEPEPEPEQEAETESHEEKSEPALEEPVSEETQKSSSSPVPVD
TAPAVQEDLRTFSWASVTSKNLPPSGAVPVSGIPPHVVKVTASQARPESKPESQTPPQRP
QRDQRVREQRTNIPPQRGPRPICEGGEQGDMDTRRIVRYPDSHQLFVGNLPHDVDKAELK
DFFQSFCVSFKGYGNVVELRINSGGKLPNFGFVVFDDPEPVQKILGSRPIMFRGEVHLNV
EEKKTRAAREGDRRDNRPRGPGGPRSGLGGGIRGSPRGGMSQKPGFGAGRGIETPRT
Download sequence
Identical sequences F6VBT0
ENSMODP00000017391 13616.ENSMODP00000017391 ENSMODP00000017391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]