SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017401 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017401
Domain Number 1 Region: 40-215
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.53e-45
Family DnaQ-like 3'-5' exonuclease 0.00000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017401   Gene: ENSMODG00000013913   Transcript: ENSMODT00000017724
Sequence length 236
Comment pep:known_by_projection chromosome:BROADO5:4:237634169:237642278:-1 gene:ENSMODG00000013913 transcript:ENSMODT00000017724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSGFLRSVLLRNLAGSGGRLGARGLRDGAAMAAGESMAQRMVWVDLEMTGLDIEKDQII
EMACLITDSDLNILAEGPNLIINQPDELLDSMSEWCKEHHGKSGLTKAVKESTITLQQAE
YEFLSFVRQQTPPGLCPLAGNSVHADKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYP
EEYEFVPKKAASHRALDDISESIKELQFYRNNIFKRKTDEKKRKIIENGENEKTVS
Download sequence
Identical sequences F6SVD7
ENSMODP00000017401 XP_001381185.2.35504 13616.ENSMODP00000017401 ENSMODP00000017401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]