SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017405 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017405
Domain Number 1 Region: 8-103
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.66e-26
Family Canonical RBD 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017405   Gene: ENSMODG00000013918   Transcript: ENSMODT00000017729
Sequence length 277
Comment pep:novel chromosome:BROADO5:4:237687456:237697016:-1 gene:ENSMODG00000013918 transcript:ENSMODT00000017729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAATAEADRTLFVGNLDCKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHE
ESVPYGMNLLNGIKLFGRPIKIQFRSGSSHASQEVSSSYSQHNLGNASPSSIPQSTSASS
SRYERNMDNLTSGYNASQMIQRSFSSPDNLQRQAVMNNVLWQQQGSFSGKFVPQHLDQPS
FTPSGQQHGHSFNLSSSSQWCQDTPVSQRKTRQNSHPYQSDRLYSREQRYGDHGSDHHYR
GNRDDSYYEDRIHDGWSHDYDSRRENSRDGKWRPSRH
Download sequence
Identical sequences F6SVB3
13616.ENSMODP00000017405 ENSMODP00000017405 ENSMODP00000017405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]