SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017452 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017452
Domain Number 1 Region: 439-537
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.78e-24
Family Canonical RBD 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017452   Gene: ENSMODG00000013957   Transcript: ENSMODT00000017777
Sequence length 554
Comment pep:known_by_projection chromosome:BROADO5:4:383842449:383849393:1 gene:ENSMODG00000013957 transcript:ENSMODT00000017777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSLKSFRTRRASPYSNGSFAGPGPRGEEPECWGLDMEAPSQTDEVLSAPARPPGPHEGR
LVGSRCTRASCVIDVRLIDGLTVAAAEAAVATTMAGTGPPPGLPGAAGAVPSGPGPGVPG
KSGEERLKEMEAEMALFEQEVLGAPISGIPTPVVPAVEPAPVIRPIIATNTYQQVQQSLE
ARAAAAATVIAPIVGPPGPFVGPVGFGPGGDRGRLDSPEARDAMFLRRAVPPQRPPILRP
AFVPHVLQRAGGPRPMALRPPHQALVGPPLPGPPGPPMMLPPMARAPGPPLGTMATLRPP
PEEPPAPRELGLGLGLGLKEKEEAAAVAVAAAAAAGLEEAGAAVGGPGAAAVIGPSLPLP
LAMPLPEPEPLPLPLEVVRGLLPPLRIPELLSLRPRPRPRPEPQPPPGLMALEVPEPLGE
DKKKGKPEKLKRCIRTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPS
FLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDV
VRKKQKEKKKLGLR
Download sequence
Identical sequences F6RSA1
ENSMODP00000017452 ENSMODP00000017452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]