SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017499 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017499
Domain Number 1 Region: 2366-2519
Classification Level Classification E-value
Superfamily SET domain 1.3e-46
Family Histone lysine methyltransferases 0.0064
Further Details:      
 
Domain Number 2 Region: 1053-1122
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000204
Family PHD domain 0.014
Further Details:      
 
Domain Number 3 Region: 1149-1217
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000687
Family PHD domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017499
Domain Number - Region: 1016-1067
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000377
Family PHD domain 0.015
Further Details:      
 
Domain Number - Region: 1260-1291
Classification Level Classification E-value
Superfamily Bromodomain 0.0484
Family Bromodomain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017499   Gene: ENSMODG00000013994   Transcript: ENSMODT00000017825
Sequence length 2519
Comment pep:known_by_projection chromosome:BROADO5:4:383923074:383937354:1 gene:ENSMODG00000013994 transcript:ENSMODT00000017825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEFRGFHSDEDVAPSSLRSALRSQRGGTPRGRARKHRTIPPPPPRPAEAVFPSQKAPSRR
RGETGKERMVQVLAELLQRAQAPPAPRIRGSESPTPRRPRGRPPGSSKKKKLPAVVAATS
APKPAAPAVPGNRRAGAWRCREAPASGSTSHKRGESGRGGRGGRGRGRGRLPLLLKFVSK
AKKMKMGQLTLGSEPGRGRGRGRRRGGGHRGVPPGRGGSSRGGGRHQKWQQQEEEEEKDE
EEKKVTKEEEEKPPSPPPPPSPPPPPPPAPEKERDTPPPMATTTRSRKRGRPPLTPTQRA
EREAARAGPEGGSPPTPVPPAGPPEESPTAPPKGTTFLKNIRQFIMPVVSARSSRLIKTP
RRFMDEEVPRPPRTEASPPPRPPVEVSPPAPQEPAPAPVPAPAPAPAPTPTPTPTPSPPP
RSPTPPPTPLPEKRRSILREPTFRWTSLSLELAPPPPPAPPPAPPPAPTTPSRRPLLLRA
PQFTPSEAHLKIYESVLTAPLTGAPDPPEPEPPPAEEPILEPESRTGSRTNHLSLPCFTP
SATTPTKAESPQGSLVPSNGQQQQQQQQQPSPQPQQLPPQPPPPDEQSLCARGTISLPLS
GVEEKMFSLLKKAKVQLFKIDQQQHQQKVAPPAPPSPGMKVEESVRAVKQSPDRGAVKSE
DELLEAKKERPPGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRERHDLA
ADDTSSASETEGISSRSRRGKVEPAGLSGSSGPTGTGGTLSHATRRSLPSHQGKKMRMAR
CGRCRGCLRLQDCGSCVNCLDKPKFGGPNTKKQCCVYRKCDKIEARKMERLAKKGRTMVK
TLLPWDSDESLEASPGPPGPRRGSGGGGPREEAVAPPGSEEQDPLLQRKSARRCVKQRPS
YDIFEDSDDSDPGVPPASRRRTPRENELPLLEPEEQSRPRKATLQPVVQLKARRRLEKDT
SAPGPFASFPNGWTGKQKSPDGIHRVRVDFKEDCDLENVWLMGGLSVLTSVPGGPPLVCL
LCASKGLHELVFCQVCCDPFHPFCLEEAERPLPQHHDTWCCRRCKFCHVCGRKGRSTKHL
LECERCRHAYHPACLGPSYPTRATRKRRHWICSACVRCKSCGAAPGKNWDSEWSGDCSLC
PGCTQLYEKGNFCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEGYEILSGLPDS
VLYTCGPCAGTAPPRWREALDGALRGGLHQVLQGLLSAKVTGPLLHCTQCGQDGEQLHRG
PCDLRAISQLFEDGHYSSVHSFMEDVVSILMRHMEEGDAPERRAVGQAKGLLLKLLESAF
SWFDAHDPKYWRRSTRLPNGVLPNAVLPPSADHIYAQWRQQESESPGSVHPPGGGAVPAT
QAKELALDPHLEDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDG
SLKNVHAAVARGRQMRCELCLKPGATVGCCLSSCLSNFHFMCARASCCIFQDDKKVFCQK
HTDLLDGKEIVTPDGFDVLRRVYVDFEGISFKRKFLTGLEPDAINVLIGSIRIDSLGTLS
DLSDCEGRLFPIGYQCSRLYWSTVDARRRCWYRCRILEYRPRGPREEPDHIGAAEENRTI
VHSPIPISGPDAVSLGPERSSLAQNTGPLPPPPEQSIAPSPVPRSVSGARIKVPNYSPSR
RPLGGVSCWPLPSPGSPSSLSHHIPTVGDPDFPAPPRRSRRPSPLASRLPPRRASPPSRP
TPQLRVPPPTSALEALMPTSGELAPPGPASSPPPPREDLGPDFEDMEVVPGLSAADLDFA
ASLLGSEPFQEEEIVAEGVGGGSRGGPGDSSEEEAGPAAHYIHFPPTVVPGPIPPPGPIP
GTPRIEQLDGVDDGTDSEAEAVQQPRGQEAPPSGPGVGGVGVGGGGGDGARPPEDLPSEI
VEFVLKNLGGAGEGGAGPGEEPPLPPPSLANGSQAPPAPLPTPTDPPRTFAWLPGAPGVR
VLSLSPAPEPPKTAASKIILVNKLGQVFVKMAGESEPAPPLPKRPPPTPPTAAPAWGLQR
GPPVCFPAPGLLRPPPPPPPSLTLVLSSGPPSPPRPAIRVKRVSTFAGRSPSAPPPNKAP
RLDGEGESPESTPQSVGALGSGLSRVRMKTPTVRGVLDLDAPGEPSRGESPTTLPDRPPL
LPLPDCGLARVSDGPPDLLLEPQWHHYSGAGEASSSEDDPPSPDDKENQGPKRTGPHLRF
EISSEDGFSVEAESLEGAWRTLIEKVQEARGHARLRHLSFSGMSGARLLGIHHDAVIFLA
EQLPGAQRCHHYKFRYHQQGEGQEEPPLNPHGAARAEVYLRKCTFDMFNFLASQHRVLPE
GAACDEEEDEVQLRSTRRATSLELPMAMRFRHLKKTSKEAVGVYRSAIHGRGLFCKRNID
AGEMVIEYSGIVIRSVLTDKREKYYDGKGIGCYMFRMDDFDVVDATMHGNAARFINHSCE
PNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKLPCNCGAKRCRRFLN
Download sequence
Identical sequences F6QK83
ENSMODP00000017499 13616.ENSMODP00000017499 ENSMODP00000017499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]