SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017514 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017514
Domain Number 1 Region: 44-145
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.7e-18
Family Splicing factor U2AF subunits 0.0000129
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017514
Domain Number - Region: 16-40
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000392
Family CCCH zinc finger 0.0055
Further Details:      
 
Domain Number - Region: 151-173
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000644
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017514   Gene: ENSMODG00000014003   Transcript: ENSMODT00000017840
Sequence length 237
Comment pep:novel chromosome:BROADO5:4:383940195:383941833:-1 gene:ENSMODG00000014003 transcript:ENSMODT00000017840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQ
TADGSHCHVSDVEVQEHYDSFFEEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRRE
EDAERAVTELNNRWFNGQAVQAELSPVTDFRESCCRQYEMGECTRGGFCNFMHLRPISRD
LRRQLYGRGKKKGLPSPFLDPRSRPFLRGPSPTRAGGGHRPRERNRRRSPDHRHGRF
Download sequence
Identical sequences F6VQW3
ENSMODP00000017514 13616.ENSMODP00000017514 ENSMODP00000017514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]