SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017559 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017559
Domain Number 1 Region: 1504-1724
Classification Level Classification E-value
Superfamily SET domain 1.06e-69
Family Histone lysine methyltransferases 0.00082
Further Details:      
 
Domain Number 2 Region: 2430-2464
Classification Level Classification E-value
Superfamily WW domain 0.00000000264
Family WW domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017559   Gene: ENSMODG00000014043   Transcript: ENSMODT00000017885
Sequence length 2606
Comment pep:known_by_projection chromosome:BROADO5:6:196849943:196969470:1 gene:ENSMODG00000014043 transcript:ENSMODT00000017885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSCNIQERQPSAIEKVLDLKLDDLGSNLCSATYLCDLGEEENEGKIENVQKMGFIKGPM
FKGVASSRFLPKGTKTKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNDKQNDTPNSPA
IPLQADFVPKIKMDPGDTSTITEESSPPKPKVELGKIHFKKHLLHVTSKPMLAAVTPVAA
SPPLPIIPSPIVTESVVTESPPQSPPPPPPALQVRTPSPPAPMSVITALPQIPTSVPVGT
SLQSPPIDVAIRTSKESLNTVVLESLELDTKQDTCSSELLDIVSQNVSENVDVSPQKEDS
HIGKEEETPDSSKSSLCYKKTSSKKKFSQSEGMFLGSESDEDSVQTSSSQRSHDFKNSAS
VEKERDSKKSLPTLKVEDLGKSSRSKTERDDKHFSYSKMDRDSRYVSSRSRSERERRRSR
SRSRSDRGPRTSSSYSRSERSHYYESERRYHRSSPYRERPRYSRSYTDNRMRESSDSEEE
YKKIYSRSSDSRRTSSHSSFYRDSRTSAYSKSDRDSKLESFHMDAEKRGKYSSKPERESK
RTSENELMKRCCSPNEMGCRRGASYSKHESNTSRNKSAPWKSTQKPDKFKSSFCCTESTE
EIKHQSHSLNLQTTCSKSNELRMVVKIPERDKTMSPSSTNRLNDSPTFKKRGESPIFKSE
FMGNDSHDSIKELDTLSKGKYDPLRTYCPMELNVNGSPGEGSDLVTFCASKTEDIFTSSD
DSINRSEVSPLIKTNKSCVLPSNGFQSINRSKEKDLDDSSVQHSELNSSLKEMDPSVPSQ
QDKFESFPVITVDYSKTIKESVDLRVSYCKTKDLDSCNTSNDNSPSLYQFETENIEPTVI
KVIPNSFMNQDSDLQSVICDNKNRKNLHSVQPTSEESEQNLRVKLASVNPCDSDSPVESS
SLASVCSLTLGMKVDNPSVIQHVEGKLPPGLDASPQNQSTEFLKHTVIEMIELNEQQITP
ETGKRVVPWKNRHNSGLLMESLQTEDEEVQEEANASLPSGREKAASTEESFKKQEGSRNM
LISGASEPLFSSCDMSGLVEGDSIAHAPKCDSSGNASEFVSPIHADYSDSSQSTSDESDT
EDTDSDDSSIPRNRLQSVVIVPKKSTLPLEETSPCSSQSSQVNRHYSDHWEDDRPDSSKS
YDERFEEMMSKNFSQTEKFSLPKGVDKSPEVPYIESNRKQMDDFELETAQPQSDGVDSTS
QADVVSDTIGLQNLEGTASKESSVVTKPILRQQEELPPYSSEGLEGTLMKSRQQNNFPNR
PDSRLGKADSDNFSSSGDFSRVDGFHSAEDLGNLGWDFSQPEKPSTTYQQPDSSYGLYAG
CNYQQSSEQYRSTHNYWQGNGFWDPRLANRPPGIVYDRIQGHIPDSLTNDHEEEDDENWN
DPRRPHFSNQSSKFLAQLHKEKGSVQAHEISSNSSKDLSVVNEKKVSPKNLEKGDMKDRG
PPKKRRQELESDSESDSDMQDRKKVRVEVEQLETLPSGSALVGPLCVMDDFRDPQRWKEC
ARQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCECTPVSKDDRAQGEIACGEDCLNR
LLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEV
LDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVN
GQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGK
MKKERSRKKDSVDGELEALLENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTQS
QSCLKSFLECHGLSLLWIWMAELGDGRGNNQKLQEEIIKTLEHLPIPTKNMLEESKVLPI
IQRWSQTKTAIPHFSEGDGYSSENTSRAHTPLNTPDPSTKPSTEADTDTPKKLVFRRLKI
ISENSMDSAISDATSELEGKDCKEDLDQLENAPVEEDEESQPQQLQPQQLTLQHLPPSKG
DIETPVDSSKPPASEPETEHEAEAKESNGPKLEEPIAMETPSQDEEEGVSDVESERSQEQ
PDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKENNGDRGRDAIGLRDQAATPKTPNR
SREREPERQTQSKEKKKRRSSLSPPPSAYERGTKRPDDRYDTPTSKKKVRLKDRNKLSTE
ERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYESLGYSGPHHSFVGYPPGYPMQAYVDP
SNPNAGKVLLPTPSMDPMCSPATYEHSQNLGHSVEPSLTTPQPVPVVQHVATPMEVSTSQ
YVAQNEAVVHQESNVAVLPASASGPVQGQSYSVWDSNQQTVTVQQPYSPAQSQTAIYYQG
QTCQTVYGVTSPYSQSTPPIVQNYPQAAGLQYIQGQQIFTAHPQSVVVQSTAAVTTIVAA
GQPQPLQQPELVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVITRQTQWD
PPTWESPGDEANLEHEAEMDLGTPTYDENPMKSSKKPKTAEADTSSELAKKSKEVFRKEM
SQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKH
KTKEYIKKYMQKFGTVYKPKEDTDLE
Download sequence
Identical sequences F6UQE2
ENSMODP00000017559 ENSMODP00000017559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]