SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017573 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017573
Domain Number 1 Region: 7-117
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.94e-32
Family Canonical RBD 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017573   Gene: ENSMODG00000014054   Transcript: ENSMODT00000017899
Sequence length 394
Comment pep:known chromosome:BROADO5:X:43223530:43230777:-1 gene:ENSMODG00000014054 transcript:ENSMODT00000017899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEADRPGKLFVGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETSKSRGFAFITFESPA
DAKDAARDMNGKLLDGKSIKVEQATKPTFESGGRRGPPPPPRSRGPPRGLRGGGRGGSGG
GTRGPPSRGGHMDDSGYSLNFNMGSSRGPLPVKRGPPPRSGGGPPPKRSAPSGPVRSSSG
MGGRAPVSRGRDSYGGPPRRDPMPSRRDVYMSPRDDGYNTKDSYSSRDYQSSRDNRDYAP
PPRDYAYRDYGHSSSRDDYQSRGYSDRDGYGGRDRDYSDHPSGGSYRDSYESYGNSRSAP
PARGPPPSYGGSSRYDDYSRDGYGGSRESYSSSRSDIYSSGRGDRVGRQDRGLPPSMDRG
YPPPRDSYSSSSRGAPRGGRGGSRSDRGGGRSRY
Download sequence
Identical sequences F6U8N4
ENSMODP00000017573 ENSMODP00000017573 XP_007507414.1.35504 13616.ENSMODP00000017573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]