SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017591 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017591
Domain Number 1 Region: 88-220
Classification Level Classification E-value
Superfamily LigT-like 0.0000418
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017591   Gene: ENSMODG00000014067   Transcript: ENSMODT00000017917
Sequence length 268
Comment pep:known_by_projection chromosome:BROADO5:1:710093694:710100560:-1 gene:ENSMODG00000014067 transcript:ENSMODT00000017917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCAALLVGYSSSSSSGSEDEDEPGRRAEAEHEKDGDSRCPPPPPRLPIPTSVLNMFPDSE
DGVVDDIEKHGGRIRTFPHERGIWATHVWVPYEAREDFFDLLSLLMTQARRVLPRLVKME
DFHLSLSQSVVLRYHWISPFVQSLKKHLASFHRFLFTANQVKVYTNQEKTRTFIGLEVTA
GHAQFLDLVSEVDKVMEEFDLSTFYKEPSFHISLAWCVGDGRSKLQAQAIQELQEIVDGF
EDSARLLCVGAEQVRCKSGNKYFSFPLK
Download sequence
Identical sequences F6TSW3
ENSMODP00000017591 ENSMODP00000017591 XP_001376322.1.35504 13616.ENSMODP00000017591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]