SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017597 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017597
Domain Number 1 Region: 233-433
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-47
Family DBL homology domain (DH-domain) 0.0000000859
Further Details:      
 
Domain Number 2 Region: 425-549
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-33
Family Pleckstrin-homology domain (PH domain) 0.00000636
Further Details:      
 
Domain Number 3 Region: 1-118
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.06e-25
Family Calponin-homology domain, CH-domain 0.00095
Further Details:      
 
Domain Number 4 Region: 163-230
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-24
Family SH3-domain 0.0000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017597   Gene: ENSMODG00000014073   Transcript: ENSMODT00000017923
Sequence length 777
Comment pep:known_by_projection chromosome:BROADO5:X:43067844:43187463:-1 gene:ENSMODG00000014073 transcript:ENSMODT00000017923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPEERIVTWLISLGVLNSPKKTICDPEEFLKVSLKNGVVLCKLLNRLVPGAVEKHCQEP
QTEADCISNIKDFLKGCACLQVEVFDPCDLYTGNNFSRVLSTLLAVNKATEDYQVSERPC
QPFSSISAVSSSQTNIPGAISNSAPVLRRHSKAAEMTENGNHQLVVRARFNFKQTNEDEL
SVCKGDIIYVTRVEEGGWWEGTLNGKTGWFPSNYVREIKPNEKPGSPKMVKGLDTLQLTK
NYYSVVLQNILETEQDYAKELQSLLGTYLRPLQSNDKLSAVEFASLLGNFEEVCTFQQTL
CQALEECAKLPENQQKVGGCLLSLMPQFKSLYLTYCANHPSAVNVITQHSDSLEKFMESQ
GAANPGILLLTTNLSKPFMRLEKYVSLLQELERHMEESHPDHQDVLKATGSFKSLVAQCQ
DLRKKKQLELQILSETIQGWEGDDIKTLGNVIFMSQVMVQGGTSEEKEERYFLLFPSVLL
MVSASPRMSGFIFQGKLPIAGMMLTRLDESEGGDYAFEIAGPLFDRMMVFCSSSQDLQEW
LDHLHRLIRGTGSGSVLVKTQSWSAQSSSSAAGQPRGPLEPPPIPKPWSLSCLRPAPPLR
PSAALGYKERMSYILKDSSKSPKTMKKFLHKRKTERKASEEEYVIRKSTAALEEDAQILR
VIEAYCTSASAGLQQSHGSGARKDSIPQVLLPEEEKIIVEETRSNGQTVIEEKSLVDTVY
ALKDEVKELKQENKKMKQCLEEELKSRKDLEKLVRRLLKQTDECMRADSGSKASLLA
Download sequence
Identical sequences F6TST1
ENSMODP00000017597 ENSMODP00000017597 XP_001363186.1.35504 XP_016282219.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]