SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017614 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017614
Domain Number 1 Region: 268-355
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.81e-23
Family Canonical RBD 0.0000373
Further Details:      
 
Domain Number 2 Region: 122-227
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.58e-17
Family Canonical RBD 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017614   Gene: ENSMODG00000014087   Transcript: ENSMODT00000017941
Sequence length 452
Comment pep:novel chromosome:BROADO5:X:42893720:42913592:1 gene:ENSMODG00000014087 transcript:ENSMODT00000017941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAQEREDMSGNQHDNNEEFTEQLRLQQLYEECSELPEGNDPYTYVDQADGTAYEWDLDK
KAWFPKITEDFLATYQANYGFPPDEPASSHPQKAKESDKNVKAGEDPTDQKTAQNSEKKQ
KGEKRKPEPGWFHVEEGRNTNVYVTGLPPDITKDEFIQLMSKCGIIMKDPQTEEYKIKLY
KDKQGNLKGDGLCCYLKKESVDLALKLLDDDVIRGYKLHVEKAKFQLKGEYDASKKKKKC
KDYRKKLSLQQKQLDWRPEKKAGSTRMRHERVVVIRNMFHPKDFEEDPLVLNEIREDLRT
ECEKFGQVKKVLLFDRHPDGVASVSYKEPEEADLCIQALNGRWFGGRQLHVEVWDGVTDY
QVEETSREREERLKGWESFLENPNTQKETHLFDPDSASGSMPLTAGKQSPENNAPKGPTK
EEVNNGESFNEDEAQSTDSSLGDSDNEDTGHL
Download sequence
Identical sequences F6R4G6
ENSMODP00000017614 XP_001362589.3.35504 ENSMODP00000017614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]