SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017721 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017721
Domain Number 1 Region: 25-301
Classification Level Classification E-value
Superfamily SET domain 3.27e-48
Family RuBisCo LSMT catalytic domain 0.0013
Further Details:      
 
Domain Number 2 Region: 331-469
Classification Level Classification E-value
Superfamily RuBisCo LSMT C-terminal, substrate-binding domain 0.00000000000122
Family RuBisCo LSMT C-terminal, substrate-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017721   Gene: ENSMODG00000014173   Transcript: ENSMODT00000018049
Sequence length 472
Comment pep:known_by_projection chromosome:BROADO5:1:709456684:709461328:-1 gene:ENSMODG00000014173 transcript:ENSMODT00000018049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAAKRPRVRKGRVEQGGGNSPLPDFLNWCRRVGLELSSKERAGGGEASGSRVPASSGL
QVSVTREGTVAGYGMVALEDVQRGELLFVVPRAVLLSQKTTAIRDLLEKEHGALQSQSGW
VPLLLALLYEYLAEDSPWSCYFSLWPDLGSLQHPMFWSEGELRQLLQGTGVPEAVQRDLA
NISQEYDAIVQPFLEAHPEIFPPQARSLELYRRLVAMVMAYSFQEPLEEEEDEKEPNPPM
MVPAADILNHVANHNANLEYSPEYLRMVATQPILKGQEIFNTYGQMANWQLVHMYGFAEP
YPGNTDDTADIQMVTVRAAALQGTTTEEERCLMCERWDFLCQLEMVGEEGAFVIGREEVL
TEEELSATLKVLCMPAKEFRELKEQDGWEEDDGDDSITLTNKTIPKLKASWKTLLRASIL
LTLQAYATDLKSEQELLSNKEAGAKLSWREEQALQVRYGQKRILHHLLELTS
Download sequence
Identical sequences F6U7C1
13616.ENSMODP00000017721 ENSMODP00000017721 ENSMODP00000017721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]