SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017728 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017728
Domain Number 1 Region: 159-410,533-640
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.67e-73
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0015
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily UBA-like 6.68e-26
Family UBA domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017728   Gene: ENSMODG00000014180   Transcript: ENSMODT00000018056
Sequence length 1072
Comment pep:known_by_projection chromosome:BROADO5:4:238404859:238465265:1 gene:ENSMODG00000014180 transcript:ENSMODT00000018056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAELQQEDAASAAESHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTD
ERVKEPSQDTIAAEPSEGEGSAANKVVPTKVIDPTHDNKDDLQAAIALSLLESPKIQTDG
RDHNRTHEATAIENKRSKRKRCEVWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQSL
FQLSEFRRLVLGYSLPQNILENCRSHTEKRNIVFMQELQYLFALMMGSNRKFVDPSAALD
LLKGAFRSADEQQQDVSEFTHKLLDWLEDAFQLAVNVNSPRNKSENPMVQLFYGTFLTEG
VHEGKTFCNNETFGQYPLQVNGYRNLDECLEGAMVEGEIEMLPPDHSVKYGQERWFTKLP
PVLTFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYSSKELIRTKREHIRKLKEEVK
VLQQKLERYVKYGSGPARFPLPDMLQYVLEFASTKPATEAPPSVHCPISDLTTKKSIRAE
EYSCQVEVPLSSLEKDNLLQTDLINKPFTSSRHSVKMPEHPAPRTITEEEMNFVKTCLQR
WRSEIEQDIQDLKNCIANTTQTIEQMYSDPLLHQVPYRLHAVLVHEGQANAGHYWAYIYN
RPRNIWLKYNDISVTESSWEELERDSYGGLRNVSAYCLMYINDKLPHFTSEAAASEPDQM
LKEVEALSVELKHYIQEDNWRFEQEVEEWEEQQSCKIPQIESSTTSESQDFSDTSQEPSL
TPSHGVRCLSSEHAVIAKDQTAQAIANTAYAYEKSGVEAALSEVMLSPAMQGVILAIAKA
RQAFDRDGSEAGLIKAFHEEYSRLYQLAKETPTPHNDPRLQHVLVYFFQNEAPKRVVERT
LLEQFADKNLSYDERSISIMKVAQAKLKEIGPDDMNMEEYKKWHEDYSLFRKVSVYLLTG
LELYQNGKCHEALSYLVYAYQSNAALLMKGPSRGVEESVIALYRRKCLLKLNSMAASLFE
TNEELNVTEGINVMNELIIPCIHLIINNDISKDDLAAIEIMRNHWCSYLGQDIAENLQLR
LGEFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGASAVTVK
Download sequence
Identical sequences F6U785
ENSMODP00000017728 13616.ENSMODP00000017728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]